gvim-9.1.0330-150500.20.12.1<>, Df&Wp9|{t՘5(l#Vӌ.Jc{4rܮ^.C^hA\ũ؋N*S?hTrS>uO8(jJߦQځP5Vsh!Ozɡ0CzU]ƭ;fo<+x "ou%s'CeO+ʁq6)4`&$OJfCZ[C.(r(k޳ĕZM7tU"&{,>H?d  ,8<HLe R0 n  (  x  * P  0 0(0(89\: >2@:BBF^GxHIpXYZ[\]P^Hbcd8e=f@lBuXvwøx4yİ6zňŘŜŢCgvim9.1.0330150500.20.12.1A GUI for ViPackage gvim contains the largest set of features of vim, which is graphical windows and language interpreter, like python, ruby, or perl. You need package vim for the help and other documentation too. If you want less features, you might want to install vim instead.f&Wh02-armsrv2LqvSUSE Linux Enterprise 15SUSE LLC Vimhttps://www.suse.com/Productivity/Text/Editorshttps://www.vim.org/linuxaarch64/usr/sbin/update-alternatives \ --install /usr/bin/vim vim /usr/bin/gvim 30 \ --slave /usr/bin/vi vi /usr/bin/gvimif [ ! -e /usr/bin/gvim ] ; then /usr/sbin/update-alternatives --remove vim /usr/bin/gvim fiJxt/)U C.&F,A큤f&Vf&Vf&Af&Af&Af&Af&Af&Af&Af&Af&Ff&Af&Af&Af&Af&Af&Af&Vf&BfNlf&Bf&Bf&Af&Af&Af&Af&Af&Af&Af&Af&A150a2b1d8307870367d90ec971e3f7595351f620e1f0ff5c273fae8682c59a71761bba80e57d7bb566bd56c4369c6777d92b54f9b77ef8a1edc3ecc4c397feeb9214a5266181ac8e4bb41475f3e1c4c9d66359d7faedf8c2a15f0cbe591a820107cb95d748bec136ced9f94fdd01de543cefb1f2a9888becbd60e76968598c846eec36bce6a7817e62c4b15940ab1b42af19292b7ed37d42e268d2c9131b2db708795d7de0debd3ce4d8d7012d3a468d0008a470abeb5b87a46f01ffb7e3ea0b0685688fa3eabffad030fb2450faff870a4db4fb3179b4bf87b1853cb625b001d203547ea1a77a3202cceda1b017a54628250e2f0443e8d947146387145eaa09051e24f1bdf0a66bc7c3d3bb811c5229dbe789119d4dde535a1b92872090cb8f7f1c006a109948927f594b3915999ed80293e0b592a7706efafedb212411be3ca7620817e07ddab0ae17a5cb7bddeda01a42119c9863aacb48f37f1784b17f225bbc8b1988690ddf5be1c0cd1847d3128da54cfd66787308238e7825ee36988cb498011da6e6641951421a79de2e1c6ed4977d08a82afc14538e957c806d7544a8fc3d48d94761e5e255c76c7ddee31b7ef5c0cde8c919cf92a3a0c08ec58390946dce274e5051e4853cb1bf3483966bb349cd2a9e575af7e773c1ffdcaff749gvimgvimgvimgvimgvimgvimgvimgvimgvimgvim/etc/alternatives/vi/etc/alternatives/vim@@Irootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootvim-9.1.0330-150500.20.12.1.src.rpmapplication()application(gvim.desktop)config(gvim)gvimgvim(aarch-64)gvim-basegvim-enhancedgvim_clientmimehandler(application/x-shellscript)mimehandler(text/english)mimehandler(text/plain)mimehandler(text/x-c)mimehandler(text/x-c++)mimehandler(text/x-c++hdr)mimehandler(text/x-c++src)mimehandler(text/x-chdr)mimehandler(text/x-csrc)mimehandler(text/x-java)mimehandler(text/x-makefile)mimehandler(text/x-moc)mimehandler(text/x-pascal)mimehandler(text/x-tcl)mimehandler(text/x-tex)vivim_client@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@    /bin/sh/bin/shconfig(gvim)gvim_clientld-linux-aarch64.so.1()(64bit)ld-linux-aarch64.so.1(GLIBC_2.17)(64bit)libICE.so.6()(64bit)libSM.so.6()(64bit)libX11.so.6()(64bit)libXt.so.6()(64bit)libacl.so.1()(64bit)libacl.so.1(ACL_1.0)(64bit)libattr.so.1()(64bit)libattr.so.1(ATTR_1.0)(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.28)(64bit)libcairo.so.2()(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.17)(64bit)libgdk-3.so.0()(64bit)libgdk_pixbuf-2.0.so.0()(64bit)libgio-2.0.so.0()(64bit)libglib-2.0.so.0()(64bit)libgobject-2.0.so.0()(64bit)libgpm.so.2()(64bit)libgtk-3.so.0()(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.17)(64bit)libm.so.6(GLIBC_2.29)(64bit)libpango-1.0.so.0()(64bit)libpangocairo-1.0.so.0()(64bit)libperl.so()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.17)(64bit)librt.so.1()(64bit)librt.so.1(GLIBC_2.17)(64bit)libselinux.so.1()(64bit)libselinux.so.1(LIBSELINUX_1.0)(64bit)libtinfo.so.6()(64bit)libtinfo.so.6(NCURSES6_TINFO_5.0.19991023)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)update-alternativesupdate-alternativesvim-data9.1.0330-150500.20.12.13.0.4-14.6.0-14.0-15.2-19.1.0330-150500.20.12.1gvim8.24.14.3f$eqe]@dܺ@dx@dldZ5dJcd'@ccR@c~ @cM@bb@`4@`.V^)@^@^2\@Zľ@ZlZ@Z%Z1@Z@V͛@V͛@VIV@V@VVŲ@V@V@VT@VV@V@V^VVuFVm]Vd#@VQ@VO @VCV VUU6@U@U@UnU@UUUx&U_@U>$U+UUQTT!TD@TfTr@T T TT|TTxcTk4T[bTBV@zbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comjehan.singh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comlnussel@suse.delnussel@suse.delnussel@suse.deidonmez@suse.comlnussel@suse.deidonmez@suse.comstefan.bruens@rwth-aachen.dekukuk@suse.delnussel@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comtchvatal@suse.comidonmez@suse.comnormand@linux.vnet.ibm.comsuse-beta@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.commpluskal@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comwerner@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comtchvatal@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comkukuk@suse.desuse-beta@cboltz.dekukuk@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comdimstar@opensuse.orgidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comcrrodriguez@opensuse.orgidonmez@suse.comidonmez@suse.comidonmez@suse.comsuse-beta@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comopensuse@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comlars@linux-schulserver.deidonmez@suse.comidonmez@suse.comidonmez@suse.comopensuse@cboltz.de- Updated to version 9.1 with patch level 0330, fixes the following problems * Fixing bsc#1220763 - vim gets Segmentation fault after updating to version 9.1.0111-150500.20.9.1 - refreshed vim-7.3-filetype_spec.patch - refreshed vim-7.3-filetype_ftl.patch - Update spec.skeleton to use autosetup in place of setup macro. - for the complete list of changes see https://github.com/vim/vim/compare/v9.1.0111...v9.1.0330- Updated to version 9.1 with patch level 0111, fixes the following security problems * Fixing bsc#1217316 (CVE-2023-48231) - VUL-0: CVE-2023-48231: vim: Use-After-Free in win_close() * Fixing bsc#1217320 (CVE-2023-48232) - VUL-0: CVE-2023-48232: vim: Floating point Exception in adjust_plines_for_skipcol() * Fixing bsc#1217321 (CVE-2023-48233) - VUL-0: CVE-2023-48233: vim: overflow with count for :s command * Fixing bsc#1217324 (CVE-2023-48234) - VUL-0: CVE-2023-48234: vim: overflow in nv_z_get_count * Fixing bsc#1217326 (CVE-2023-48235) - VUL-0: CVE-2023-48235: vim: overflow in ex address parsing * Fixing bsc#1217329 (CVE-2023-48236) - VUL-0: CVE-2023-48236: vim: overflow in get_number * Fixing bsc#1217330 (CVE-2023-48237) - VUL-0: CVE-2023-48237: vim: overflow in shift_line * Fixing bsc#1217432 (CVE-2023-48706) - VUL-0: CVE-2023-48706: vim: heap-use-after-free in ex_substitute * Fixing bsc#1219581 (CVE-2024-22667) - VUL-0: CVE-2024-22667: vim: stack-based buffer overflow in did_set_langmap function in map.c * Fixing bsc#1215005 (CVE-2023-4750) - VUL-0: CVE-2023-4750: vim: Heap use-after-free in function bt_quickfix - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.2103...v9.1.0111- Updated to version 9.0 with patch level 2103, fixes the following security problems * Fixing bsc#1215940 (CVE-2023-5344) - VUL-0: CVE-2023-5344: vim: Heap-based Buffer Overflow in vim prior to 9.0.1969. * Fixing bsc#1216001 (CVE-2023-5441) - VUL-0: CVE-2023-5441: vim: segfault in exmode when redrawing * Fixing bsc#1216167 (CVE-2023-5535) - VUL-0: CVE-2023-5535: vim: use-after-free from buf_contents_changed() * Fixing bsc#1216696 (CVE-2023-46246) - VUL-0: CVE-2023-46246: vim: Integer Overflow in :history command * Fixing bsc#1214922 (CVE-2023-4738) - VUL-0: CVE-2023-4738: vim: heap-buffer-overflow in vim_regsub_both * Fixing bsc#1214924 (CVE-2023-4735) - VUL-0: CVE-2023-4735: vim: OOB Write ops.c * Fixing bsc#1214925 (CVE-2023-4734) - VUL-0: CVE-2023-4734: vim: segmentation fault in function f_fullcommand * Fixing bsc#1215004 (CVE-2023-4733) - VUL-0: CVE-2023-4733: vim: use-after-free in function buflist_altfpos * Fixing bsc#1215006 (CVE-2023-4752) - VUL-0: CVE-2023-4752: vim: Heap Use After Free in function ins_compl_get_exp * Fixing bsc#1215033 (CVE-2023-4781) - VUL-0: CVE-2023-4781: vim: heap-buffer-overflow in function vim_regsub_both - drop patches: disable-unreliable-tests.patch ignore-flaky-test-failure.patch vim-8.1.0297-dump3.patch - dropped %check - most of tests didn't work correctly in OBS and maintenance burden of this was getting too big - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1632...v9.0.2103- Use app icon generated from vimlogo.eps in source tarball; add higher res icons of sizes 128, 256, and 512px as png sources. Our current icons deviate from upstream flatpaks for example. - Updated to version 9.0 with patch level 1632 - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1443...v9.0.1632- Updated to version 9.0 with patch level 1572, fixes the following security problems * Fixing bsc#1210996 (CVE-2023-2426) - VUL-0: CVE-2023-2426: vim: Use of Out-of-range Pointer Offset in GitHub repository vim/vim prior to 9.0.1499. * Fixing bsc#1211256 (CVE-2023-2609) - VUL-1: CVE-2023-2609: vim: NULL Pointer Dereference prior to 9.0.1531 * Fixing bsc#1211257 (CVE-2023-2610) - VUL-1: CVE-2023-2610: vim: Integer Overflow or Wraparound prior to 9.0.1532 - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1443...v9.0.1572- Fixing bsc#1211461 - L3: vim "eats" first character from prompt in xterm * Add: reorder-exit-raw-mode.patch * Swaps out_str_t_TE() and cursor_on() during exit to prevent missing characters in xterm prompt on exit.- Fixing bsc#1211144 - [Build 96.1] openQA test fails in zypper_migration - conflict between xxd and vim * Revert the creation standalone xxd packages- Updated to version 9.0 with patch level 1443, fixes the following security problems * Fixing bsc#1209042 (CVE-2023-1264) - VUL-0: CVE-2023-1264: vim: NULL Pointer Dereference vim prior to 9.0.1392 * Fixing bsc#1209187 (CVE-2023-1355) - VUL-0: CVE-2023-1355: vim: NULL Pointer Dereference prior to 9.0.1402. * Fixing bsc#1208828 (CVE-2023-1127) - VUL-1: CVE-2023-1127: vim: divide by zero in scrolldown() - drop vim-8.0-ttytype-test.patch as it changes test_options.vim which we remove during %prep anyway. And this breaks quilt setup. - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1386...v9.0.1443- Updated to version 9.0 with patch level 1386, fixes the following security problems * Fixing bsc#1207780 - (CVE-2023-0512) VUL-0: CVE-2023-0512: vim: Divide By Zero in GitHub repository vim/vim prior to 9.0.1247 * Fixing bsc#1208957 - (CVE-2023-1175) VUL-0: CVE-2023-1175: vim: Incorrect Calculation of Buffer Size * Fixing bsc#1208959 - (CVE-2023-1170) VUL-0: CVE-2023-1170: vim: Heap-based Buffer Overflow in vim prior to 9.0.1376 * Fixing bsc#1208828 - (CVE-2023-1127) VUL-1: CVE-2023-1127: vim: divide by zero in scrolldown() - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1234...v9.0.1386- Updated to version 9.0 with patch level 1234, fixes the following security problems * Fixing bsc#1207396 VUL-0: CVE-2023-0433: vim: Heap-based Buffer Overflow in vim prior to 9.0.1225 * Fixing bsc#1207162 VUL-1: CVE-2023-0288: vim: Heap-based Buffer Overflow in GitHub repository vim/vim prior to 9.0.1189. * Fixing bsc#1206868 VUL-1: CVE-2023-0054: vim: Out-of-bounds Write in GitHub repository vim/vim prior to 9.0.1145. * Fixing bsc#1206867 VUL-1: CVE-2023-0051: vim: Heap-based Buffer Overflow in GitHub repository vim/vim prior to 9.0.1144. * Fixing bsc#1206866 VUL-1: CVE-2023-0049: vim: Out-of-bounds Read in GitHub repository vim/vim prior to 9.0.1143. - refreshed vim-7.4-highlight_fstab.patch - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1040...v9.0.1234- Updated to version 9.0 with patch level 1040, fixes the following security problems * Fixing bsc#1206028 VUL-0: CVE-2022-3491: vim: Heap-based Buffer Overflow prior to 9.0.0742 * Fixing bsc#1206071 VUL-0: CVE-2022-3520: vim: Heap-based Buffer Overflow * Fixing bsc#1206072 VUL-0: CVE-2022-3591: vim: Use After Free * Fixing bsc#1206075 VUL-0: CVE-2022-4292: vim: Use After Free in GitHub repository vim/vim prior to 9.0.0882. * Fixing bsc#1206077 VUL-0: CVE-2022-4293: vim: Floating Point Comparison with Incorrect Operator in GitHub repository vim/vim prior to 9.0.0804. * Fixing bsc#1205797 VUL-0: CVE-2022-4141: vim: heap-buffer-overflow in alloc.c 246:11 * Fixing bsc#1204779 VUL-0: CVE-2022-3705: vim: use after free in function qf_update_buffer of the file quickfix.c - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.814...v9.0.1040- Updated to version 9.0 with patch level 0814, fixes the following problems * Fixing bsc#1192478 VUL-1: CVE-2021-3928: vim: vim is vulnerable to Stack-based Buffer Overflow * Fixing bsc#1203508 VUL-0: CVE-2022-3234: vim: Heap-based Buffer Overflow prior to 9.0.0483. * Fixing bsc#1203509 VUL-1: CVE-2022-3235: vim: Use After Free in GitHub prior to 9.0.0490. * Fixing bsc#1203820 VUL-0: CVE-2022-3324: vim: Stack-based Buffer Overflow in prior to 9.0.0598. * Fixing bsc#1204779 VUL-0: CVE-2022-3705: vim: use after free in function qf_update_buffer of the file quickfix.c * Fixing bsc#1203152 VUL-1: CVE-2022-2982: vim: use after free in qf_fill_buffer() * Fixing bsc#1203796 VUL-1: CVE-2022-3296: vim: stack out of bounds read in ex_finally() in ex_eval.c * Fixing bsc#1203797 VUL-1: CVE-2022-3297: vim: use-after-free in process_next_cpt_value() at insexpand.c * Fixing bsc#1203110 VUL-1: CVE-2022-3099: vim: Use After Free in ex_docmd.c * Fixing bsc#1203194 VUL-1: CVE-2022-3134: vim: use after free in do_tag() * Fixing bsc#1203272 VUL-1: CVE-2022-3153: vim: NULL Pointer Dereference in GitHub repository vim/vim prior to 9.0.0404. * Fixing bsc#1203799 VUL-1: CVE-2022-3278: vim: NULL pointer dereference in eval_next_non_blank() in eval.c * Fixing bsc#1203924 VUL-1: CVE-2022-3352: vim: vim: use after free * Fixing bsc#1203155 VUL-1: CVE-2022-2980: vim: null pointer dereference in do_mouse() * Fixing bsc#1202962 VUL-1: CVE-2022-3037: vim: Use After Free in vim prior to 9.0.0321 - ignore-flaky-test-failure.patch: Ignore failure of flaky tests - disable-unreliable-tests-arch.patch: Removed - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.0313...v9.0.0814- Updated to version 9.0 with patch level 0313, fixes the following problems * Fixing bsc#1200884 Vim: Error on startup * Fixing bsc#1200902 VUL-0: CVE-2022-2183: vim: Out-of-bounds Read through get_lisp_indent() Mon 13:32 * Fixing bsc#1200903 VUL-0: CVE-2022-2182: vim: Heap-based Buffer Overflow through parse_cmd_address() Tue 08:37 * Fixing bsc#1200904 VUL-0: CVE-2022-2175: vim: Buffer Over-read through cmdline_insert_reg() Tue 08:37 * Fixing bsc#1201249 VUL-0: CVE-2022-2304: vim: stack buffer overflow in spell_dump_compl() * Fixing bsc#1201356 VUL-1: CVE-2022-2343: vim: Heap-based Buffer Overflow in GitHub repository vim prior to 9.0.0044 * Fixing bsc#1201359 VUL-1: CVE-2022-2344: vim: Another Heap-based Buffer Overflow vim prior to 9.0.0045 * Fixing bsc#1201363 VUL-1: CVE-2022-2345: vim: Use After Free in GitHub repository vim prior to 9.0.0046. * Fixing bsc#1201620 PUBLIC SUSE Linux Enterprise Server 15 SP4 Basesystem zbalogh@suse.com NEW --- SLE-15-SP4-Full-x86_64-GM-Media1 and vim-plugin-tlib-1.27-bp154.2.18.noarch issue * Fixing bsc#1202414 VUL-1: CVE-2022-2819: vim: Heap-based Buffer Overflow in compile_lock_unlock() * Fixing bsc#1202552 VUL-1: CVE-2022-2874: vim: NULL Pointer Dereference in generate_loadvar() * Fixing bsc#1200270 VUL-1: CVE-2022-1968: vim: use after free in utf_ptr2char * Fixing bsc#1200697 VUL-1: CVE-2022-2124: vim: out of bounds read in current_quote() * Fixing bsc#1200698 VUL-1: CVE-2022-2125: vim: out of bounds read in get_lisp_indent() * Fixing bsc#1200700 VUL-1: CVE-2022-2126: vim: out of bounds read in suggest_trie_walk() * Fixing bsc#1200701 VUL-1: CVE-2022-2129: vim: out of bounds write in vim_regsub_both() * Fixing bsc#1200732 VUL-1: CVE-2022-1720: vim: out of bounds read in grab_file_name() * Fixing bsc#1201132 VUL-1: CVE-2022-2264: vim: out of bounds read in inc() * Fixing bsc#1201133 VUL-1: CVE-2022-2284: vim: out of bounds read in utfc_ptr2len() * Fixing bsc#1201134 VUL-1: CVE-2022-2285: vim: negative size passed to memmove() due to integer overflow * Fixing bsc#1201135 VUL-1: CVE-2022-2286: vim: out of bounds read in ins_bytes() * Fixing bsc#1201136 VUL-1: CVE-2022-2287: vim: out of bounds read in suggest_trie_walk() * Fixing bsc#1201150 VUL-1: CVE-2022-2231: vim: null pointer dereference skipwhite() * Fixing bsc#1201151 VUL-1: CVE-2022-2210: vim: out of bounds read in ml_append_int() * Fixing bsc#1201152 VUL-1: CVE-2022-2208: vim: null pointer dereference in diff_check() * Fixing bsc#1201153 VUL-1: CVE-2022-2207: vim: out of bounds read in ins_bs() * Fixing bsc#1201154 VUL-1: CVE-2022-2257: vim: out of bounds read in msg_outtrans_special() * Fixing bsc#1201155 VUL-1: CVE-2022-2206: vim: out of bounds read in msg_outtrans_attr() * Fixing bsc#1201863 VUL-1: CVE-2022-2522: vim: out of bounds read via nested autocommand * Fixing bsc#1202046 VUL-1: CVE-2022-2571: vim: Heap-based Buffer Overflow related to ins_comp_get_next_word_or_line() * Fixing bsc#1202049 VUL-1: CVE-2022-2580: vim: Heap-based Buffer Overflow related to eval_string() * Fixing bsc#1202050 VUL-1: CVE-2022-2581: vim: Out-of-bounds Read related to cstrchr() * Fixing bsc#1202051 VUL-1: CVE-2022-2598: vim: Undefined Behavior for Input to API related to diff_mark_adjust_tp() and ex_diffgetput() * Fixing bsc#1202420 VUL-1: CVE-2022-2817: vim: Use After Free in f_assert_fails() * Fixing bsc#1202421 VUL-1: CVE-2022-2816: vim: Out-of-bounds Read in check_vim9_unlet() * Fixing bsc#1202511 VUL-1: CVE-2022-2862: vim: use-after-free in compile_nested_function() * Fixing bsc#1202512 VUL-1: CVE-2022-2849: vim: Invalid memory access related to mb_ptr2len() * Fixing bsc#1202515 VUL-1: CVE-2022-2845: vim: Buffer Over-read related to display_dollar() * Fixing bsc#1202599 VUL-1: CVE-2022-2889: vim: use-after-free in find_var_also_in_script() in evalvars.c * Fixing bsc#1202687 VUL-1: CVE-2022-2923: vim: NULL Pointer Dereference in GitHub repository vim/vim prior to 9.0.0240 * Fixing bsc#1202689 VUL-1: CVE-2022-2946: vim: use after free in function vim_vsnprintf_typval * Fixing bsc#1202862 VUL-1: CVE-2022-3016: vim: Use After Free in vim prior to 9.0.0285 Mon 12:00- Deleted patches: * restrict-shell-commands.patch * source-check-sandbox.patch * vim-8.0.1568-CVE-2021-3778.patch * vim-8.0.1568-CVE-2021-3796.patch * vim-8.0.1568-CVE-2021-3872.patch * vim-8.0.1568-CVE-2021-3927.patch * vim-8.0.1568-CVE-2021-3928.patch * vim-8.0.1568-CVE-2021-3984.patch * vim-8.0.1568-CVE-2021-4019.patch * vim-8.0.1568-CVE-2021-4193.patch * vim-8.0.1568-CVE-2021-46059.patch * vim-8.0.1568-CVE-2022-0319.patch * vim-8.0.1568-CVE-2022-0351.patch * vim-8.0.1568-CVE-2022-0361.patch * vim-8.0.1568-CVE-2022-0413.patch * vim-8.0.1568-globalvimrc.patch - Added patches: * vim-8.1.0297-dump3.patch * vim-8.2.2411-globalvimrc.patch * disable-unreliable-tests-arch.patch - Updated patches: * disable-unreliable-tests.patch * vim-7.3-filetype_changes.patch * vim-7.3-filetype_ftl.patch * vim-7.3-filetype_spec.patch * vim-7.3-gvimrc_fontset.patch * vim-7.3-help_tags.patch * vim-7.3-mktemp_tutor.patch * vim-7.3-name_vimrc.patch * vim-7.3-sh_is_bash.patch * vim-7.3-use_awk.patch * vim-7.4-disable_lang_no.patch * vim-7.4-filetype_apparmor.patch * vim-7.4-filetype_mine.patch * vim-7.4-highlight_fstab.patch * vim-8.0-ttytype-test.patch * vim-8.0.1568-defaults.patch * vim73-no-static-libpython.patch - Updated to version 8.2 with patch level 5038, fixes the following problems * Fixing bsc#1191770 VUL-0: CVE-2021-3875: vim: heap-based buffer overflow * Fixing bsc#1192167 VUL-0: CVE-2021-3903: vim: heap-based buffer overflow * Fixing bsc#1192902 VUL-0: CVE-2021-3968: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1192903 VUL-0: CVE-2021-3973: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1192904 VUL-0: CVE-2021-3974: vim: vim is vulnerable to Use After Free * Fixing bsc#1193466 VUL-1: CVE-2021-4069: vim: use-after-free in ex_open() in src/ex_docmd.c * Fixing bsc#1193905 VUL-0: CVE-2021-4136: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1194093 VUL-1: CVE-2021-4166: vim: vim is vulnerable to Out-of-bounds Read * Fixing bsc#1194216 VUL-1: CVE-2021-4193: vim: vulnerable to Out-of-bounds Read * Fixing bsc#1194217 VUL-0: CVE-2021-4192: vim: vulnerable to Use After Free * Fixing bsc#1194872 VUL-0: CVE-2022-0261: vim: Heap-based Buffer Overflow in vim prior to 8.2. * Fixing bsc#1194885 VUL-0: CVE-2022-0213: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1195004 VUL-0: CVE-2022-0318: vim: Heap-based Buffer Overflow in vim prior to 8.2. * Fixing bsc#1195203 VUL-0: CVE-2022-0359: vim: heap-based buffer overflow in init_ccline() in ex_getln.c * Fixing bsc#1195354 VUL-0: CVE-2022-0407: vim: Heap-based Buffer Overflow in Conda vim prior to 8.2. * Fixing bsc#1198596 VUL-0: CVE-2022-1381: vim: global heap buffer overflow in skip_range * Fixing bsc#1199331 VUL-0: CVE-2022-1616: vim: Use after free in append_command * Fixing bsc#1199333 VUL-0: CVE-2022-1619: vim: Heap-based Buffer Overflow in function cmdline_erase_chars * Fixing bsc#1199334 VUL-0: CVE-2022-1620: vim: NULL Pointer Dereference in function vim_regexec_string * Fixing bsc#1199747 VUL-0: CVE-2022-1796: vim: Use After in find_pattern_in_path * Fixing bsc#1200010 VUL-0: CVE-2022-1897: vim: Out-of-bounds Write in vim * Fixing bsc#1200011 VUL-0: CVE-2022-1898: vim: Use After Free in vim prior to 8.2 * Fixing bsc#1200012 VUL-0: CVE-2022-1927: vim: Buffer Over-read in vim prior to 8.2 * Fixing bsc#1070955 VUL-1: CVE-2017-17087: vim: Sets the group ownership of a .swp file to the editor's primary group, which allows local users to obtain sensitive information * Fixing bsc#1194388 VUL-1: CVE-2022-0128: vim: vim is vulnerable to Out-of-bounds Read * Fixing bsc#1195332 VUL-1: CVE-2022-0392: vim: Heap-based Buffer Overflow in vim prior to 8.2 * Fixing bsc#1196361 VUL-1: CVE-2022-0696: vim: NULL Pointer Dereference in vim prior to 8.2 * Fixing bsc#1198748 VUL-1: CVE-2022-1420: vim: Out-of-range Pointer Offset * Fixing bsc#1199651 VUL-1: CVE-2022-1735: vim: heap buffer overflow * Fixing bsc#1199655 VUL-1: CVE-2022-1733: vim: Heap-based Buffer Overflow in cindent.c * Fixing bsc#1199693 VUL-1: CVE-2022-1771: vim: stack exhaustion in vim prior to 8.2. * Fixing bsc#1199745 VUL-1: CVE-2022-1785: vim: Out-of-bounds Write * Fixing bsc#1199936 VUL-1: CVE-2022-1851: vim: out of bounds read- Minimal fix for Bug 1195004 - (CVE-2022-0318) VUL-0: CVE-2022-0318: vim: Heap-based Buffer Overflow in vim prior to 8.2. / vim-8.0.1568-CVE-2022-0413.patch - Fixing bsc#1190570 CVE-2021-3796: vim: use-after-free in nv_replace() in normal.c / vim-8.0.1568-CVE-2021-3796.patch - Fixing bsc#1191893 CVE-2021-3872: vim: heap-based buffer overflow in win_redr_status() drawscreen.c / vim-8.0.1568-CVE-2021-3872.patch - Fixing bsc#1192481 CVE-2021-3927: vim: vim is vulnerable to Heap-based Buffer Overflow / vim-8.0.1568-CVE-2021-3927.patch - Fixing bsc#1192478 CVE-2021-3928: vim: vim is vulnerable to Stack-based Buffer Overflow / vim-8.0.1568-CVE-2021-3928.patch - Fixing bsc#1193294 CVE-2021-4019: vim: vim is vulnerable to Heap-based Buffer Overflow / vim-8.0.1568-CVE-2021-4019.patch - Fixing bsc#1193298 CVE-2021-3984: vim: illegal memory access when C-indenting could lead to Heap Buffer Overflow / vim-8.0.1568-CVE-2021-3984.patch - Fixing bsc#1190533 CVE-2021-3778: vim: Heap-based Buffer Overflow in regexp_nfa.c / vim-8.0.1568-CVE-2021-3778.patch - Fixing bsc#1194216 CVE-2021-4193: vim: vulnerable to Out-of-bounds Read / vim-8.0.1568-CVE-2021-4193.patch - Fixing bsc#1194556 CVE-2021-46059: vim: A Pointer Dereference vulnerability exists in Vim 8.2.3883 via the vim_regexec_multi function at regexp.c, which causes a denial of service. / vim-8.0.1568-CVE-2021-46059.patch - Fixing bsc#1195066 CVE-2022-0319: vim: Out-of-bounds Read in vim/vim prior to 8.2. / vim-8.0.1568-CVE-2022-0319.patch - Fixing bsc#1195126 CVE-2022-0351: vim: uncontrolled recursion in eval7() / vim-8.0.1568-CVE-2022-0351.patch - Fixing bsc#1195202 CVE-2022-0361: vim: Heap-based Buffer Overflow in vim prior to 8.2. / vim-8.0.1568-CVE-2022-0361.patch - Fixing bsc#1195356 CVE-2022-0413: vim: use after free in src/ex_cmds.c / vim-8.0.1568-CVE-2022-0413.patch- install suse vimrc in /usr (boo#1182324, vim-8.0.1568-globalvimrc.patch)- source correct suse.vimrc file (boo#1182324)- stop owning /etc/vimrc so the old, distro provided config actually gets removed. Leaving it around leads to a duplicated autocmd for * .spec, leading to spec file template inserted twice. - own some dirs in vim-data-common so installation of vim-small doesn't leave not owned directories (boo#1173256). - Add vi as slave to update-alternatives so that every package has a matching "vi" symlink (bsc#1174564, boo#1176549).- Add restrict-shell-commands.patch to disable using interfaces in restricted mode, fixes bsc#1172225 CVE-2019-20807- introduce vim-small package with reduced requirements for small installations (boo#1166602). - BuildRequire pkg-config(krb5) instead of krb5-mini to be able to build against Tumbleweed repo.- Add source-check-sandbox.patch to fix CVE-2019-12735 boo#1137443- Pre-convert gvim icons, otherwise building vim depends on rsvg-convert -> librsvg -> cargo -> Rust -> LLVM - Cleanup SVG icon, make lines pixel-grid aligned - Correct RPM Group- Use %license instead of %doc [bsc#1082318]- instead of explicitly unsetting mouse, remove it from the defaults in the first place (boo#1079185, vim-8.0.1568-defaults.patch)- Switch to make -j1 clean to see if it fixes random build failures on Leap/SLE 15.- Updated to revision 1568, fixes the following problems * No test using a screen dump yet. * Screen dump test fails on MS-Windows. * Dead code found. * Assert_equalfile() does not close file descriptors. (Coverity) * Dump test fails when using a shadow directory. * Cannot use 24 bit colors in MS-Windows console. * Compiler warnings without termguicolors feature. * Libterm doesn't support requesting fg and bg color. * C syntax test fails when using gvim * C syntax test still fails when using gvim. * Quotestar test is flaky when using the GUI. * Xxd does not skip NUL lines when using ebcdic. * Popupmenu is too far left when completion is long. (Linwei) * No test for the popup menu positioning. * Popup menu positioning fails with longer string. * synpat_T is taking too much memory. * Terminal screen dump does not include cursor position. * With 'termguicolors' Normal color doesn't work correctly. * When using 'termguicolors' SpellBad doesn't show. * Screen dumps not included in distribution. * Using feedkeys() in a terminal window may trigger mappings. (Charles Sheridan) * Undo in the options window makes it empty. * Screen dump test script not included in distribution. * Various small problems in test files. * Various small problems in source files. * On Mac 'maxmemtot' is set to a weird value. * May leak file descriptors when executing job. * Cannot see what digraph is used to insert a character. * Custom plugins loaded with --clean. * Build error for some combination of features. * May not parse the t_RS response correctly, resulting in wrong characters in the input stream. * printf() does not work with only one argument. (Daniel Hahler) * No right-click menu in a terminal. * Build failure without GUI. * Build failure without GUI on MS-Windows. * Crash with rust syntax highligting. (Edd Barrett) * The terminal debugger can't set a breakpoint with the mouse. * Timeout of getwinposx() can be too short. (lilydjwg) * Too many #ifdefs. * Can't build Mac version without GUI. * Too many #ifdefs. * Cannot build Win32 GUI without IME. (John Marriott) * Can't build on older Mac, header file is missing.- Recommend vim-data so that colors can work by default- Updated to revision 1525, fixes the following problems * Compiler complains about uninitialized variable. (Tony Mechelynck) * Missing -D_FILE_OFFSET_BITS=64 may cause problems if a library is compiled with it. * Cannot act on edits in the command line. * Acessing freed memory after window command in auto command. (gy741) * Still too many old style tests. * Segmentation fault when Ruby throws an exception inside :rubyfile command. * Slow redrawing with DirectX. * Endless loop when gui_mch_stop_blink() is called while blink_state is BLINK_OFF. (zdohnal) * It is difficult to set the python home directory properly for Python 2.7 and 3.5 since both use $PYTHONHOME. * Terminal test fails on some systems. (jonathonf) * Terminal test fails on some slow terminals. * When in silent mode too much output is buffered. * If $SHELL contains a space then the default value of 'shell' is incorrect. (Matthew Horan) * Timer test on travis Mac is still flaky. * Clojure now supports a shebang line. * Filetype detection test does not check all scripts. * Cannot handle change of directory. * Missing file in patch. * Missing another file in patch. * Missing yet another file in patch. * Test fails without 'autochdir' option. * Completing directory after :find does not add slash. * Python2 and python3 detection not tested. (Matej Cepl) * Older GTK versions don't have gtk_entry_get_text_length(). * Libvterm doesn't handle illegal byte sequence correctly. * Illegal memory access in del_bytes(). * When package path is a symlink adding it to 'runtimepath' happens at the end. * Integer overflow when using regexp pattern. (geeknik) * On MS-Windows CursorIM highlighting no longer works. * MS-Windows: nsis installer is a bit slow. * MS-Windows: D&D fails between 32 and 64 bit apps. * Visual C 2017 has multiple MSVCVER numbers. * Invalid memory access in read_redo(). (gy741) * Screen isn't always updated right away. * Redraw flicker when moving the mouse outside of terminal window. * Unnecessary condition for "len" being zero. * Insert mode completion state is confusing. * Patch missing change. * Clearing a pointer takes two lines. * Using feedkeys() does not work to test Insert mode completion. (Lifepillar) * Searchpair() might return an invalid value on timeout. * Reduntant conditions. * Weird autocmd may cause arglist to be changed recursively. * Accessing invalid memory with "it". (Dominique Pelle) * Test 14 fails. * Emacs tags no longer work. (zdohnal) * There is no easy way to get the global directory, esp. if some windows have a local directory. * Number of spell regions is spread out through the code. * The minimum width of the popup menu is hard coded. * Memory leak in balloon_split(). * Completion items cannot be annotated. * No autocmd triggered in Insert mode with visible popup menu. * Having 'pumwidth' default to zero has no merit. * Clearing a pointer takes two lines. * Getting the jump list requires parsing the output of :jumps. * Getjumplist() returns duplicate entries. (lacygoill) * Out-of-memory situation not correctly handled. (Coverity) * Possible NULL pointer dereference. (Coverity) * Out-of-memory situation not correctly handled. (Coverity) * In out-of-memory situation character is not restored. (Coverity) * Access memory beyond end of string. (Coverity) * Win32: the screen may be cleared on startup. * Debugger can't break on a condition. (Charles Campbell) * New version of HP NonStop (Tandem) doesn't like the default header for setenv(). * Timer test is a bit flaky. * The :drop command is not always available. * Test for failing drag-n-drop command no longer fails. * Cannot test if a command causes a beep. * Some code for the debugger watch expression is clumsy. * Warning for possibly using NULL pointer. (Coverity) * The jumplist is not always properly cleaned up. * Getting the list of changes is not easy. * BufWinEnter event fired when opening hidden terminal. * Errors for job options are not very specific. * Invalid memory acces with pattern using look-behind match. (Dominique Pelle) * Error messages suppressed after ":silent! try". (Ben Reilly) * Getchangelist() does not use argument as bufname(). * Cursor is in the wrong line when using a WinBar in a Terminal window. * Shift-Tab does not work in a terminal window. * Popup menu is positioned in the wrong place. (Davit Samvelyan, Boris Staletic) * Cannot write and read terminal screendumps. * Compiler warnings for uninitialized variables. (Tony Mechelynck) * Using :wqa exits even if a job runs in a terminal window. (Jason Felice)- Split vim-data into vim-data-common package for low-disk usage scenarios bsc#1078722 bsc#1078554 bsc#1075541 - Make set mouse= default in suse.vimrc bsc#1079185 bsc#1078564 bsc#1067890 bsc#1064068 bsc#1062691- Updated to revision 1442, fixes the following problems * Crash when calling term_start() with empty argument. * Crash when term_start() fails. * MS-Windows: vimtutor fails if %TMP% has special chars. * After ":copen" can't get the window-ID of the quickfix window. (FalacerSelene) * Illegal memory access after undo. (Dominique Pelle) * GTK: :promtfind does not put focus on text input. (Adam Novak) * Memory leak in test_arabic. * Not enough information about what Python version may work. * Pkg-config doesn't work with cross compiling. * Filetype detection test not updated for change. * If cscope fails a search Vim may hang. * Terminal window: some vterm responses are delayed. * Using ":undo 0" leaves undo in wrong state. * Using pointer before it is set.- Make vim require vim-data bsc#1077352 bsc#1075541 bsc#1074790- Sort with spec-cleaner - Add conditional to build with python2 in order to build with py3 only enviroment - Convert dependencies to pkgconfig style- Updated to revision 1428, fixes the following problems * No test for expanding backticks. * Cursor column is not updated after ]s. (Gary Johnson) * Accessing freed memory in vimgrep. * Accessing invalid memory with overlong byte sequence. * No fallback to underline when undercurl is not set. (Ben Jackson) * Error in return not caught by try/catch. * The timer_pause test is flaky on Travis. * execute() does not work in completion of user command. (thinca) * "gf" and don't accept ? and & in URL. (Dmitrii Tcyganok) * The :leftabove modifier doesn't work for :copen. * Compiler warning on 64 bit MS-Windows system.- ignore make check transient errors for PowerPC bypass boo#1072651- Update apparmor.vim (taken from AppArmor 2.12) * add support for the "smc" network keyword- Updated to revision 1417, fixes the following problems * Encoding empty string to JSON sometimes gives "null". * Build fails with --with-features=huge --disable-channel. * Too much highlighting with 'hlsearch' and 'incsearch' set. * Cannot intercept a yank command. * It is not easy to see if a colorscheme is well written. * Memory leak when CTRL-G in search command line fails. * Pattern with \& following nothing gives an error. * :packadd does not load packages from the "start" directory. * Warnings and errors when building tiny version. (Tony Mechelynck) * Color scheme check script shows up as color scheme. * Cannot build with GTK but without XIM. (Guido) * Crash with nasty autocommand. (gy741, Dominique Pelle) * Using freed buffer in grep command. (gy741, Dominique Pelle) * Invalid memory access on exit when autocommands wipe out a buffer. * Duplicated code for getting a typed character. CursorHold is called too often in the GUI. (lilydjwg) * Difficult to track changes to a quickfix list. * GUI: CursorHold may trigger before 'updatetime' when using timers. * Crash in setqflist(). * Buffer overflow in :tags command. * Hang when using count() with an empty string. * Reading invalid memory with CTRL-W :. * Using free memory using setloclist(). (Dominique Pelle) * Accessing freed memory in :cbuffer. * Accessing freed memory in :lfile. * Warning for unused function without timers feature. * Crash when searching for a sentence. * Test doesn't search for a sentence. Still fails when searching for start of sentence. (Dominique Pelle)- Updated to revision 1390, fixes the following problems * Balloon shows when cursor is in WinBar. * terminal test hangs, executing abcde. (Stucki) * Cannot drag status line or vertical separator of new terminal window. (UncleBill) * MS-Windows: drawing underline, curl and strike-throw is slow, mFallbackDC not properly updated. * Channel test for callback is flaky. * Shift-Insert doesn't always work in MS-Windows console. * Profile log may be truncated halfway a character. * No error when settting 'renderoptions' to an invalid value before starting the GUI. * CTRL-A does not work with an empty line. (Alex) * Window size wrong after maximizing with WinBar. (Lifepillar) * Cursor in terminal not always updated. * Cannot call a dict function in autoloaded dict. * Autoload script sources itself when defining function. * Configure check for selinux does not check for header file. * When recovering a file with "vim -r swapfile" the hit-enter prompt is at the top of the window. * ch_readraw() waits for NL if channel mode is NL. * Get "no write since last change" message if a terminal is open. * Local additions in help skips some files. (joshklod) * Not enough quickfix help; confusing winid. * Python 3.5 is getting old. * Cannot select modified buffers with getbufinfo(). * Wordcount test is old style. * Char not overwritten with ambiguous width char, if the ambiguous char is single width but we reserve double-width space. * getqflist() items are missing if not set, that makes it more difficult to handle the values. * DirectX scrolling can be slow, vertical positioning is off.- Updated to revision 1365, fixes the following problems * Libvterm ANSI colors can not always be recognized from the RGB values. The default color is wrong when t_RB is empty. * The Terminal highlighting doesn't work in a terminal. * Some users don't want to diff with hidden buffers. * Terminal window colors wrong when using Terminal highlighting. * Recovering does not work when swap file ends in .stz. * There is no easy way to get the window position. * When one channel test fails others fail as well.- Update to revision 1358 * Too many changes to list - Fixes CVE-2017-1000382 bsc#1065958 - Refresh patches: * disable-unreliable-tests.patch * vim-7.3-filetype_spec.patch * vim-7.4-disable_lang_no.patch * vim-7.4-highlight_fstab.patch * vim-8.0-ttytype-test.patch- Explicitly require python2-devel- Add disable-unreliable-tests.patch to disable unreliable tests bsc#1054723- Bump priorities so we can upgrade from 12.3- Updated to revision 627, fixes the following problems * Call for requesting color and ambiwidth is too early. (Hirohito Higashi) * "1gd" may hang. * Bracketed paste is still enabled when executing a shell command. (Michael Smith) * Can't run make with several jobs, creating directories has a race condition. * The cursor line number becomes negative when using :z^ in an empty buffer. (neovim #6557) * Building the command table requires Perl. * Running parallel make after distclean fails. (Manuel Ortega) * Get only one quickfix list after :caddbuf. * Using freed memory when resetting 'indentexpr' while evaluating it. (Dominique Pelle) * Can't build when configure choses "install-sh". (Daniel Hahler) * Warning for uninitialized variable. (John Marriott) * :simalt on MS-Windows does not work properly. * Duplicate test case for quickfix. * Cannot set the valid flag with setqflist(). * Moving folded text is sometimes not correct. * Illegal memory access with z= command. (Dominique Pelle) * Fold test hangs on MS-Windows. * Memory leak when executing quickfix tests. * Test_options fails when run in the GUI. * No test for mapping timing out. * Configure check for return value of tgetent is skipped. * job_stop() often assumes the channel will be closed, while the job may not actually be stopped. (Martin Gammelsæter) * :simalt still does not work. * Cannot add a context to locations. * Changes to eval functionality not documented. * If a job writes to a buffer and the user is typing a command, the screen isn't updated. When a message is displayed the changed buffer may cause it to be cleared. (Ramel Eshed) * Duplication of code for adding a list or dict return value. * Build failure when windows feature is missing. * Coverity warning for not checking return value of dict_add(). * Crash when complete() is called after complete_add() in 'completefunc'. (Lifepillar) * Off-by-one error in buffer size computation. * Building with gcc 7.1 yields new warnings. * diff mode is insufficiently tested * test_recover fails on some systems. * No test coverage for :spellrepall. * When gF fails to edit the file the cursor still moves to the found line number. * gF test fails on MS-Windows. * gF test fails still on MS-Windows. * The buffer that quickfix caches for performance may become invalid. (Daniel Hahler) * Cannot set the context for a specified quickfix list. * When creating a bufref, then using :bwipe and :new it might get the same memory and bufref_valid() returns true. * Cannot manipulate other than the current quickfix list. * For some people the hint about quitting is not sufficient. * The screen is redrawn when t_BG is set and used to detect the value for 'background'. * When t_u7 is sent a few characters in the second screen line are overwritten and not redrawn later. (Rastislav Barlik) * Package directories are added to 'runtimepath' only after loading non-package plugins. * The conf filetype detection is done before ftdetect scripts from packages that are added later. * float2nr() is not exactly right. * Using % with :hardcopy wrongly escapes spaces. (Alexey Muranov) * When setting the cterm background with ":hi Normal" the value of 'background' may be set wrongly. * Hardcopy test hangs on MS-Windows. * NFA regex engine handles [0-z] incorrectly. * In the GUI, when a timer uses feedkeys(), it still waits for an event. (Raymond Ko) * Since we only support GTK versions that have it, the ckeck for HAVE_GTK_MULTIHEAD is no longer needed. * The ":stag" command does not respect 'switchbuf'. * Using a text object to select quoted text fails when 'selection' is set to "exclusive". (Guraga) * The message "Invalid range" is used for multiple errors. * Warning for unused variable in tiny build. (Tony Mechelynck) * shellescape() always escapes a newline, which does not work with some shells. (Harm te Hennepe) * In the GUI the cursor may flicker. * When 'wrapscan' is off "gn" does not select the whole pattern when it's the last one in the text. (KeyboardFire)- Extend vimrc with mappings for 8-bit controls key escape sequences- Conflict with old vim versions to fix the upgrade from 12.3 boo#1036583- Updated to revision 566, fixes the following problems * :windo allows for ! but it's not supported. * Undefined behavior when using backslash after empty line. * Not enough test coverage for syntax commands. * Crash when getting the window position in tmux. * Cannot detect Bazel BUILD files on some systems. * Using freed memory in :caddbuf after clearing quickfix list. * Setting nocompatible for the tiny version moves the cursor. - Refresh and re-add vim-8.0-ttytype-test.patch- Updated to revision 559, fixes the following problems * Test_edit causes older xfce4-terminal to close. (Dominique Pelle) * Cppcheck warnings. * Edit test may fail on some systems. * Swap file exists briefly when opening the command window. * Extra line break in verbosefile when using ":echomsg". (Ingo Karkat) * Saving the redo buffer only works one time, resulting in the "." command not working well for a function call inside another function call. * No test for the 8g8 command. * Some etags format tags file use 0x01, breaking the parsing. * The typeahead buffer is reallocated too often. * Toupper and tolower don't work properly for Turkish when 'casemap' is empty. (Bjorn Linse) * Toupper/tolower test with Turkish locale fails on Mac. * Toupper and tolower don't work properly for Turkish when 'casemap' contains "keepascii". (Bjorn Linse) * Toupper/tolower test fails on OSX without Darwin. * Getting the window position fails if both the GUI and term code is built in. * GTK: using static gravities is not useful. * The :ownsyntax command is not tested. * Setting ttytype to xxx does not always fail as expected. - Remove vim-8.0-ttytype-test.patch, fixed upstream.- Update the update-alternatives code- Updated to revision 542, fixes the following problems * ml_get errors in silent Ex mode. (Dominique Pelle) * A large count on a normal command causes trouble. (Dominique Pelle) * There is no way to remove quickfix lists (for testing). * Storing a zero byte from a multi-byte character causes fold text to show up wrong. * Character classes are not well tested. They can differ between platforms. * Using a function pointer instead of the actual function, which we know. * GtkForm handling is outdated. * MS-Windows: when 'clipboard' is "unnamed" yyp does not work in a :global command. * dv} deletes part of a multi-byte character. (Urtica Dioica) * Folds are messed up when 'encodin' is "utf-8". * Coverity complains about possible negative value. * RISC OS support was removed long ago, but one file is still included. * When 'wildmenu' is set and 'wildmode' has "longest" then the first file name is highlighted, even though the text shows the longest match. * Line in test commented out. * Buffer overflow when 'columns' is very big. (Nikolai Pavlov) * Test with long directory name fails on non-unix systems. * Test with long directory name fails on Mac. * Abbreviation doesn't work after backspacing newline. (Hkonrk) * Defaults.vim does not work well with tiny features. (crd477) * Memory leak when exiting from within a user function. * Quickfix window not updated when freeing quickfix stack. * Illegal memory access with :z and large count. * No test for falling back to default term value. * Startup test fails on Mac. * Building unit tests fails. * Compiler warning on MS-Windows. * getpos() can return a negative line number. (haya14busa)- Update spec.skeleton with spec-cleaner- Updated to revision 514, fixes the following problems * Insufficient testing for statusline. * 'makeencoding' missing from the options window. * Git and hg see new files after running tests. (Manuel Ortega) * Options test does not always test everything. * Options test fails or hangs on MS-Windows. * 'cinoptions' cannot set indent for extern block. * "make shadow" creates an invalid link. * Quite a few beeps when running tests. * Clang version not correctly detected. * Some functions are not tested. * Running the options test sometimes resizes the terminal. * The packadd test does not create the symlink correctly and does not test the right thing. * The fnamemodify test changes 'shell' in a way later tests may not be able to use system(). * Using ":%argdel" while the argument list is already empty gives an error. (Pavol Juhas) * Not enough test coverage in Insert mode. * Dead code in #ifdef. * Patch shell command uses double quotes around the argument, which allows for $HOME to be expanded. (Etienne) * Terminal width is set to 80 in test3. * Diffpatch fails when the file name has a quote. * Getpgid is not supported on all systems. * The ";" command does not work after characters with a lower byte that is NUL. * Getting font name does not work on X11. * Some macros are in lower case, which can be confusing. * Part of fold patch accidentally included. * v:progpath is not reliably set. * Some macros are in lower case. * Some macros are in lower case. * Adding fold marker creates new comment. * Compiler warnings for comparing unsigned char with 256 always being true. (Manuel Ortega) * The mode test may hang in Test_mode(). (Michael Soyka) * Typo in MinGW test makefile. * Using :move messes up manual folds. * Potential crash if adding list or dict to dict fails. * Old fix for :move messing up folding no longer needed, now that we have a proper solution. * Can't build on HPUX. * Test 45 hangs on MS-Windows. * If an MS-Windows tests succeeds at first and then fails in a way it does not produce a test.out file it looks like the test succeeded. * Resetting 'compatible' in defaults.vim has unexpected side effects. (David Fishburn) * Can't find executable name on Solaris and FreeBSD. * Off-by-one error in using :move with folding. * There are still a few macros that should be all-caps. * Using g< after :for does not show the right output. (Marcin Szamotulski) * After aborting an Ex command g< does not work. (Marcin Szamotulski) * Compiler warnings on MS-Windows. * Not enough testing for help commands. * Exit callback test sometimes fails. * When a test fails and test.log is created, Test_edit_CTRL_I matches it instead of test1.in. * No test covering arg_all(). * The client-server feature is not tested. * Not enough testing for the client-server feature. * Missing change to main.c. * The client-server test may hang when failing. * Tests use assert_true(0) and assert_false(1) to report errors. * remote_peek() is not tested. * The remote_peek() test fails on MS-Windows. * Unnecessary if statement. * The setbufvar() function may mess up the window layout. (Kay Z.) * Illegal memory access when using :all. (Dominique Pelle) * Using :lhelpgrep with an argument that should fail does not produce an error if the previous :helpgrep worked. * Not all windows commands are tested. * Crash and endless loop when closing windows in a SessionLoadPost autocommand. * The autocmd test hangs on MS-Windows. * Running tests leaves an "xxx" file behind. * Clipboard and "* register is not tested. * Splitting a 'winfixwidth' window vertically makes it one column smaller. (Dominique Pelle) * The quotestar test fails when a required feature is missing. * A failing client-server request can make Vim hang. * Crash with cd command with very long argument. * Build failure with older compiler on MS-Windows. * The quotestar test uses a timer instead of a timeout, thus it cannot be rerun like a flaky test. * Insufficient testing for folding. * Arabic support is not fully tested. * Two autocmd tests are skipped on MS-Windows. * taglist() does not prioritize tags for a buffer. * Quotestar test is still a bit flaky. * On MS-Windows ":!start" does not work as expected. * Coverity complains about possible NULL pointer. * Endless loop in updating folds with 32 bit ints. * Looking up an Ex command is a bit slow. * Failed window split for :stag not handled. (Coverity CID 99204) * Can't build with ANSI C. * Client-server tests fail when $DISPLAY is not set. * Coveralls no longer shows per-file coverage. * No link to codecov.io results. * Typo in link to codecov.io results. * Menuage for skipping client-server tests is unclear. * Check for available characters takes too long. * Getting name of cleared highlight group is wrong. (Matt Wozniski) * Script for creating cmdidxs can be improved.- Disable term=xxx test, does not work with any vim version * vim-8.0-ttytype-test.patch- Update apparmor.vim (taken from AppArmor 2.11) * add support for the "kcm" and "qipcrtr" network keywords * update change_profile rule highlighting- Build default vim without X11 support, use update-alternatives to prefer gvim if installed for X11 support.- Updated to revision 425, fixes the following problems * Packadd test does not clean up symlink. * Packadd test uses wrong directory name. * The E11 error message in the command line window is not translated. * The "zero count" error doesn't have a number. (Hirohito Higashi) * Xfontset and guifontwide are not tested. * Illegal memory access after "vapo". (Dominique Pelle) * Restoring help snapshot accesses freed memory. (Dominique Pelle) * GUI test fails on some systems. * Illegal memory access when 'complete' ends in a backslash. * Can't access b:changedtick from a dict reference. * Functions test fails. * Flags of :substitute not sufficiently tested. * Invalid memory access in :recover command. * :recover test fails on MS-Windows. * Illegal memory access with vi' * Not checking return valud of dict_add(). (Coverity) * When using complete() and typing a character undo is saved after the character was inserted. (Shougo) * Double free when compiled with EXITFREE and setting 'ttytype'. * b:changedtick can be unlocked, even though it has no effect. * Unlet command leaks memory. (Nikolai Pavlov) * islocked('d.changedtick') does not work. * Vim relies on limits.h to be included indirectly, but on Solaris 9 it may not be. (Ben Fritz) * When using CTRL-X CTRL-U inside a comment, the use of the comment leader may not work. (Klement) * When building with a shadow directory on macOS lacks the +clipboard feature. * Redrawing errors with GTK 3. * Not enough test coverage for Perl. * No test for concatenating an empty string that results from out of bounds indexing. * The condition for when a typval needs to be cleared is too complicated. * If [RO] in the status line is translated to a longer string, it is trunctted to 4 bytes. * Test to check that setting termcap key fails sometimes. * Using uninitialized memory when 'isfname' is empty. * Leaking memory when setting 'ttytype'. * Crash when setting 'guicursor' to weird value. * Invalid memory access in C-indent code. * 'number' and 'relativenumber' are not properly tested. * Sometimes VimL is used, which is confusing. * GUI initialisation is not sufficiently tested. * Tests fail on MS-Windows. * Travis is too slow to keep up with patches. * ]s does not move cursor with two spell errors in one line. * Might free a dict item that wasn't allocated. * Build fails with tiny features. * If configure defines _LARGE_FILES some include files are included before it is defined. * Not all options are tested with a range of values. * The 'balloondelay', 'ballooneval' and 'balloonexpr' options are not defined without the +balloon_eval feature. Testing that an option value fails does not work for unsupported options. * Invalid memory access when setting wildchar empty. * Leaking memory when setting v:completed_item. * More options are not always defined. * Build fails without +folding. * Invalid memory access when using :sc in Ex mode. (Dominique Pelle) * The "+ register is not tested. * Size computations in spell file reading are not exactly right. * Possible overflow when reading corrupted undo file. CVE-2017-6349 bsc#1027057 * Another possible overflow when reading corrupted undo file. CVE-2017-6350 bsc#1027053 * CTRL-Z and mouse click use CTRL-O unnecessary. * With 'linebreak' set and 'breakat' includes ">" a double-wide character results in "<<" displayed. * Diff mode is not sufficiently tested. * Warning in tiny build for unused variable. (Tony Mechelynck) * Misplaced #ifdef. (Christ van Willigen) * Timer test failed for no apparent reason. * No tests for arabic. * Tiny build has a problem with generating the options test. * compiler warnings * filtering lines through "cat", without changing the line count, changes manual folds. * Test for arabic does not check what is displayed. * When the window scrolls horizontally when the popup menu is displayed part of it may not be cleared. (Neovim issue #6184) * Arabic support is verbose and not well tested. * GUI test fails with Athena and Motif. * When the same tag appears more than once, the order is unpredictable. (Charles Campbell) * Tabs are not aligned when scrolling horizontally and a Tab doesn't fit. (Axel Bender) * Testing the + register fails with Motif. * 'balloonexpr' only works synchronously. * Cannot build with the viminfo feature but without the eval feature. * Illegal memory access with "t". * Crash when using balloon_show() when not supported. (Hirohito Higashi) * Some tests have a one second delay. * Test fails with missing balloon feature. * :map completion does not have . (Dominique Pelle) * GUI tests may fail. * Not enough testing for quickfix. * v:progpath may become invalid after ":cd". * The arabic shaping code is verbose. * Filtering folds with marker method not tested. * Updating folds does not work properly when inserting a file and a few other situations. * set_progpath is defined but not always used * Newer gettext/iconv library has extra dll file. * We can't change the case in menu entries, it breaks translations. * Menu test fails on MS-Windows. * Menu test fails on MS-Windows using gvim. * Balloon eval is not tested. * Balloon test fails on MS-Windows. * Setting v:progpath is not quite right. * Test for the clipboard fails sometimes. * ASAN logs are disabled and don't cause a failure. * Test for v:progpath fails on MS-Windows. * When running :make the output may be in the system encoding, different from 'encoding'. * Diff mode is displayed wrong when adding a line at the end of a buffer. * Python test fails with Python 3.6. * The effect of adding "#" to 'cinoptions' is not always removed. * Compiler warnings on MS-Windows. (Ajit Thakkar) * Build errors when building without folding. - Drop test87-python36.patch, fixed upstream.- Add test87-python36.patch to update test results for Python 3.6- Updated to revision 324, fixes the following problems * When a json message arrives in pieces, the start is dropped and the decoding fails. * Not enough testing for GUI functionality. * getcmdtype(), getcmdpos() and getcmdline() are not tested. * ":help :[range]" does not work. (Tony Mechelynck) * ":help z?" does not work. (Pavol Juhas) * No test for setting 'guifont'. * Small mistake in 7x13 font name. * Insert mode completion does not respect "start" in 'backspace'. * Warning for unused variable with small build. * When using the tiny version trying to load the matchit plugin gives an error. On MS-Windows some default mappings fail. * Possible overflow with spell file where the tree length is corrupted. CVE-2017-5953 bsc#1024724 * When running the command line tests there is a one second wait. * Illegal memory access with "1;y".- Updated to revision 311, fixes the following problems * Double free on exit when using a closure. (James McCoy) * Ex command range with repeated search does not work. (Bruce DeVisser) * When the GUI window is resized Vim does not always take over the new size. (Luchr) * Cannot stop diffing hidden buffers. (Daniel Hahler) * No tests for ":set completion" and various errors of the :set command. * Cannot set terminal key codes with :let. * Bracketed paste does not work in Visual mode. * Assign test fails in the GUI. * Invalid memory access when option has duplicate flag. * mode() not sufficiently tested. * Asan detects a memory error when EXITFREE is defined. (Dominique Pelle) * When using a symbolic link, the package path will not be inserted at the right position in 'runtimepath'. (Dugan Chen, Norio Takagi) * Cannot use an empty key in json. * Not enough testing for GUI functionality. * Linebreak tests are old style.- Updated to revision 296, fixes the following problems * Jumping to a tag that is a static item in the current file fails. (Kazunobu Kuriyama) * The test for :profile is slow and does not work on MS-Windows. * On MS-Windows the system() test skips a few parts. * Some syntax arguments take effect even after "if 0". (Taylor Venable) * Warning for an unused parameter when the libcall feature is disabled. Warning for a function type cast when compiling with -pedantic. * Some syntax arguments are not tested. * When completing a group name for a highlight or syntax command cleared groups are included. * No test for invalid syntax group name. * Order of complication flags is sometimes wrong. * Compiler warns for uninitialized variable. (Tony Mechelynck) * After :undojoin some commands don't work properly, such as :redo. (Matthew Malcomson) * Test coverage for :retab insufficient. * Leaking file descriptor when system() cannot find the buffer. (Coverity) * Internally used commands for CTRL-Z and mouse click end up in history. (Matthew Malcomson) * When using :substitute with the "c" flag and 'cursorbind' is set the cursor is not updated in other windows. * Vim does not support bracketed paste, as implemented by xterm and other terminals. * Build fails if the multi-byte feature is disabled. * The buffer used to store a key name theoreticaly could be too small. (Coverity) * The Netbeans "specialKeys" command does not check if the argument fits in the buffer. (Coverity) * Leaking memory when syntax cluster id is unknown. (Coverity) * When a Cscope line contains CTRL-L a NULL pointer may be used. (Coverity) * When decoding JSON with a JS style object the JSON test may use a NULL pointer. (Coverity) * Build fails without the cscope feature. * No command line completion for :cexpr, :cgetexpr, :caddexpr, etc. * Ubsan reports errors for integer overflow. * Completion for :match does not show "none" and other missing highlight names. * Checking if PROTO is defined inside a function has no effect. * When a multi-byte character ends in a zero byte, putting blockwise text puts it before the character instead of after it. * Coverity gets confused by the flags passed to find_tags() and warnts for an uninitialized variable. * When 'fileformats' is changed in a BufReadPre auto command, it does not take effect in readfile(). (Gary Johnson) * When a block is visually selected and put is used on the end of the selection only one line is changed. * The test for patch 8.0.0224 misses the CR characters and passes even without the fix. (Christian Brabandt) * Crash when 'fileformat' is forced to "dos" and the first line in the file is empty and does not have a CR character. * When pasting test in an xterm on the command line it is surrounded by and . (Johannes Kaltenbach) * When freeing a buffer the local value of the 'formatprg' option is not cleared. * When using bracketed paste line breaks are not respected. * There are no tests for bracketed paste mode. * Pasting in Insert mode does not work when bracketed paste is used and 'esckeys' is off. * The paste test fails if the GUI is being used. * When several lines are visually selected and one of them is short, using put may cause a crash. (Axel Bender) * Memory leak detected when running tests for diff mode. * Gcc complains that a variable may be used uninitialized. Confusion between variable and label name. (John Marriott) * When setting wildoptions=tagfile the completion context is not set correctly. (desjardins) * When using bracketed paste autoindent causes indent to be increased. * The address sanitizer sometimes finds errors, but it needs to be run manually. * The clang build on CI fails with one configuration. * Vim defines a mch_memmove() function but it doesn't work, thus is always unused. * Completion of user defined functions is not covered by tests. * When making a character lower case with tolower() changes the byte cound, it is not made lower case. * When the user sets t_BE empty after startup to disable bracketed paste, this has no direct effect. * The generated zh_CN.cp936.po message file is not encoded properly. * Compiler warnings for int to pointer conversion. * Under some circumstances, one needs to type Ctrl-N or Ctrl-P twice to have a menu entry selected. (Lifepillar) * vim_strcat() cannot handle overlapping arguments. * When two submits happen quick after each other, the tests for the first one may error out. * When virtcol() gets a column that is not the first byte of a multi-byte character the result is unpredictable. (Christian Ludwig) * It is not so easy to write a script that works with both Python 2 and Python 3, even when the Python code works with both. * Characters below 256 that are not one byte are not always recognized as word characters. * When creating a session when winminheight is 2 or larger and loading that session gives an error. * When using an assert function one can either specify a message or get a message about what failed, not both. * When calling setpos() with a buffer argument it often is ignored. (Matthew Malcomson) * Tests fail because some changes were not included. * The keyword test file is not included in the archive. * The keyword test file is not included in the archive. * Tab commands do not handle count correctly. (Ken Hamada) * Build fails with tiny features. * Not enough test coverage for eval functions. * Farsi support is barely tested. * Farsi support is not tested enough. * Memory error reported by ubsan, probably for using the string returned by execute(). * May get ml_get error when :pydo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * Compiler warning for using uninitialized variable. * A channel test sometimes fails on Mac. * May get ml_get error when :luado deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :perldo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :rubydo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :tcldo deletes lines or switches to another buffer. (Nikolai Pavlov, closes #1421) * Crash on exit is not detected when running tests. * Dead code detected by Coverity when not using gnome. * When update_single_line() is called recursively, or another screen update happens while it is busy, errors may occur. * When checking for CTRL-C typed the GUI may detect a screen resize and redraw the screen, causing trouble. * Checking for FEAT_GUI_GNOME inside GTK 3 code is unnecessary. * The GUI test may trigger fontconfig and take a long time. * GUI test fails on MS-Windows. * With MSVC 2015 the dll name is vcruntime140.dll. * On MS-Windows setting an environment variable with multi-byte strings does not work well. * MS-Windows files are still using ARGSUSED while most other files have UNUSED. * When doing a Visual selection and using "I" to go to insert mode, CTRL-O needs to be used twice to go to Normal mode. (Coacher) * The return value of mode() does not indicate that completion is active in Replace and Insert mode. (Zhen-Huan (Kenny) Hu) * The Test_collapse_buffers() test failed once, looks like it is flaky. * Tests fail with tiny build on Unix. * When concealing is active and the screen is resized in the GUI it is not immediately redrawn. * Cannot access the arguments of the current function in debug mode. (Luc Hermitte) * Errors reported while running tests. * No test for "ga" and :ascii. * If a wide character doesn't fit at the end of the screen line, and the line doesn't fit on the screen, then the cursor position may be wrong. (anliting) * Visual block insertion does not insert in all lines. * The stat test is a bit slow. * Some tests have a one or three second wait. * Argument list is not stored correctly in a session file. (lgpasquale) * test_viml hangs. * Bracketed paste can only append, not insert.- Improve summary bsc#1021040- Add missing %changelog to spec.skeleton- Updated to revision 194, fixes the following problems * When compiling with EBCDIC defined the build fails. (Yaroslav Kuzmin) * For completion "locale -a" is executed on MS-Windows, even though it most likely won't work. * Setting language in gvim on MS-Windows does not work when libintl.dll is dynamically linked with msvcrt.dll. * Using :change in between :function and :endfunction fails. * When opening a buffer on a directory and inside a try/catch then the BufEnter event is not triggered. * test_command_count may fail when a previous test interferes, seen on MS-Windows. * 'formatprg' is a global option but the value may depend on the type of buffer. (Sung Pae) * Error E937 is used both for duplicate key in JSON and for trying to delete a buffer that is in use. * When 'cursorbind' and 'cursorcolumn' are both on, the column highlignt in non-current windows is wrong. * When 'cursorbind' and 'cursorline' are set, but 'cursorcolumn' is not, then the cursor line highlighting is not updated. (Hirohito Higashi) * Ubsan warns for using a pointer that is not aligned. * When in Ex mode and an error is caught by try-catch, Vim still exits with a non-zero exit code. * The system() test fails on MS-Windows. * The error message from assert_notequal() is confusing. * Building with a new Ruby version fails. * Using NOT_VALID for redraw_later() to update the cursor line/column highlighting is not efficient. * There are no tests for the :profile command. * Detecting duplicate tags uses a slow linear search. * Some systems do not have ruby_sysinit(), causing the build to fail. * Build fails with tiny features. * Accidentally removed #ifdef. * Profile tests fails if total and self time are equal.- Updated to revision 172, fixes the following problems * When a C preprocessor statement has two line continuations the following line does not have the right indent. (Ken Takata) * ":earlier" and ":later" do not work after startup or reading the undo file. * When the pattern of :filter does not have a separator then completion of the command fails. * To pass buffer content to system() and systemlist() one has to first create a string or list. * Running the channel test creates channellog. * system() test fails on MS-Windows. * system() test fails on OS/X. * When sorting zero elements a NULL pointer is passed to qsort(), which ubsan warns for. * Several float functions are not covered by tests. * No command line completion for ":syntax spell" and ":syntax sync". * On MS-Windows some float functions return a different value when passed unusual values. strtod() doesn't work for "inf" and "nan". * Using a NULL pointer when using feedkeys() to trigger drawing a tabline. * EMSG() is sometimes used for internal errors. * Build fails when using small features. * Build error on Fedora 23 with small features and gnome2. * Ruby 2.4 no longer supports rb_cFixnum. * Outdated and misplaced comments. * Ubsan warns for integer overflow. * JSON with a duplicate key gives an internal error. (Lcd) * str2nr() and str2float() do not always work with negative values. * Still some float functionality is not covered by tests. * For complicated string json_decode() may run out of stack space. * Channel test fails for using freed memory. * JS style JSON does not support single quotes. * The command selected in the command line window is not executed. (Andrey Starodubtsev)- Updated to revision 147, fixes the following problems * Not enough test coverage for syntax commands. * Test fails because of using :finish. * "2;'(" causes ml_get errors in an empty buffer. * Null pointer access reported by UBsan. * An address relative to the current line, ":.,+3y", does not work properly on a closed fold. * When using indent folding and changing indent the wrong fold is opened. * When 'maxfuncdepth' is set above 200 the nesting is limited to 200. * Small build fails. * Warning for unused argument. * Pasting inserted text in Visual mode does not work properly. * Nested function test fails on AppVeyor. * Normal colors are wrong with 'termguicolors'. * Line number of current buffer in getbufinfo() is wrong. * When using MSVC the GvimExt directory is cleaned twice. * Running tests on MS-Windows is a little bit noisy. * When using 'termguicolors' on MS-Windows the RGB definition causes the colors to be wrong. * searchpair() does not work when 'magic' is off.- Updated to revision 130, fixes the following problems * Not enough testing for entering Ex commands. * Display problem with 'foldcolumn' and a wide character. (esiegerman) * Cancelling completion still inserts text when formatting is done for 'textwidth'. (lacygoill) * Display test fails on MS-Windows. * Parallel make still doesn't work. (Lewis Muir) * Configure uses "ushort" while the Vim code doesn't.- Updated to revision 124, fixes the following problems * May not process channel readahead. (skywind) * Value of 'thesaurus' option not checked properly. * When using ch_read() with zero timeout, can't tell the difference between reading an empty line and nothing available. * Cannot use a semicolon in 'backupext'. (Jeff) * When reading channel output in a timer, messages may go missing. (Skywind) * The channel "drop" option is not tested. * Still checking if memcmp() exists while every system should have it now. * Drop command doesn't use existing window. * The :history command is not tested. * Tests 92 and 93 are old style. * When reading English help and using CTRl-] the language from 'helplang' is used. * Parallel make fails. (J. Lewis Muir) * No test for using CTRL-R on the command line. * Setting 'cursorline' changes the curswant column. (Daniel Hahler) * Internal error for assert_inrange(1, 1).- Updated to revision 101, fixes the following problems * When the input or output is not a tty Vim appears to hang. * When a channel callback consumes a lot of time Vim becomes unresponsive. (skywind) * Can't build on MS-Windows. * Popup menu always appears above the cursor when it is in the lower half of the screen. (Matt Gardner) * Options that are a file name may contain non-filename characters. * Some options are not strictly checked. * (after 8.0.0101) cannot set 'dictionary' to a path- Updated to revision 95, fixes the following problems * Problems with GTK 3.22.2 fixed in 3.22.4.- Export "TERM=linux" before running the test suite: vim does quite an extensive test relying on a full fledged terminal inside OBS, stdio is redirected to a serial console (where the build log is being recorded/extracted. Systemd set non-local tty by default to vt220 in upcoming versions (which the vi test suite fails to run on; this should be considered a vim bug).- Updated to revision 92, fixes the following problems * Using NUL instead of NULL. * Crash when using the preview window from an unnamed buffer. (lifepillar) * On Windows job_stop() stops cmd.exe, not the processes it runs. (Linwei) * When a match ends in part of concealed text highlighting, it might mess up concealing by resetting prev_syntax_id. * An exiting job is detected with a large latency. * New code for job_stop() breaks channel test on AppVeyor. * Conceal test passes even without the bug fix. * No test for what 8.0.0047 fixes. * On Windows job_stop() stops cmd.exe, not the processes it runs. (Linwei) * Minor comment and style deficiencies. * When setting 'filetype' there is no check for a valid name. * Tests fail without the 'keymap' features. * Positioning of the popup menu is not good. * Vim does not build on VMS systems. * When using an Ex command for 'keywordprg' it is escaped as with a shell command. (Romain Lafourcade) * Compiler warning for unused variable. * No digraph for HORIZONTAL ELLIPSIS. * Compiler warning for comparing with unsigned. (Zoltan Arpadffy) * Normal test fails on MS-Windows. * Compiler warning for unused function in tiny build. (Tony Mechelynck) * when calling an operator function when 'linebreak' is set, it is internally reset before calling the operator function. * VMS has a problem with infinity. * Checking did_throw after executing autocommands is wrong. (Daniel Hahler) * Compiler warning for self-comparison. * Tests referred in Makefile that no longer exist. * Exit value from a shell command is wrong. (Hexchain Tong) * MS-Windows: Crash with long font name. (Henry Hu) * More comparisons between firstwin and lastwin. * Cannot make Vim fail on an internal error. * Using number for exception type lacks type checking. * Channel log has double parens ()(). * The GUI code is not tested by Travis. * Accessing freed memory in quickfix. * Accessing freed memory in quickfix. (Domenique Pelle) * The OS X build fails on Travis. * Inconsistent function names. * Extension for configure should be ".ac". * Using freed memory with win_getid(). (Domenique Pelle) * Using freed memory when adding to a quickfix list. (Domenique Pelle) * Using freed memory with recursive function call. (Dominique Pelle) * Cannot add a comment after ":hide". (Norio Takagi) * When the channel callback gets job info the job may already have been deleted. (lifepillar) * When a test fails in Setup or Teardown the problem is not reported. * Various problems with GTK 3.22.2. * Cursor moved after last character when using 'breakindent'. * Test_help_complete sometimes fails in MS-Windows console. * C indenting does not support nested namespaces that C++ 17 has. - Drop bsc-1008800.patch, fixed upstream.- Add bsc-1008800.patch to fix gvim rendering with recent gtk+ update. Fixes bsc#1008800. Patch by Jan Alexander Steffens.- Updated to revision 45, fixes the following problems * Cannot use overlapping positions with matchaddpos(). * No completion for ":messages". * Order of matches for 'omnifunc' is messed up. (Danny Su) * Detecting that a job has finished may take a while. * Get E924 when switching tabs. * OPEN_CHR_FILES not defined for FreeBSD using Debian userland files. * When Vim 8 reads an old viminfo and exits, the next time marks are not read from viminfo. (Ned Batchelder) * Whole line highlighting with matchaddpos() does not work. * When using Insert mode completion but not actually inserting anything an undo item is still created. (Tommy Allen) * When using Insert mode completion with 'completeopt' containing "noinsert" change is not saved for undo. (Tommy Allen) * When using Insert mode completion with 'completeopt' containing "noinsert" with CTRL-N the change is not saved for undo. (Tommy Allen) * In diff mode the cursor may end up below the last line, resulting in an ml_get error. * Calling job_stop() right after job_start() does not work.- Updated to revision 32, fixes the following problems * getwinvar() returns wrong Value of boolean and number options, especially non big endian systems. (James McCoy) * A string argument for function() that is not a function name results in an error message with NULL. (Christian Brabandt) * Netbeans test fails with Python 3. (Jonathonf) * ":lb" is interpreted as ":lbottom" while the documentation says it means ":lbuffer". * Vim 7.4 is still mentioned in a few places. * Popup complete test is disabled. * Unnecessary workaround for AppVeyor. * Crash when editing file that starts with crypt yeader. (igor2x) * On OSX Test_pipe_through_sort_all() sometimes fails. * Typos in comments. * Missing comma in list. * Crypt tests are old style. * Can't tell which part of a channel has "buffered" status. * Build fails. * Cannot get the number of the current quickfix or location list. * When using ":sleep" channel input is not handled. * Test_command_count is old style. * The regexp engines are not reentrant. * In the GUI when redrawing the cursor it may be on the second half of a double byte character. * If a channel in NL mode is missing the NL at the end the remaining characters are dropped. * "gd" and "gD" may find a match in a comment or string. * When the netbeans channel closes, "DETACH" is put in the output part. (Ozaki Kiichi) * Inconsistent use of spaces vs tabs in gd test. * Error format with %W, %C and %Z does not work. (Gerd Wachsmuth) * A channel is closed when reading on stderr or stdout fails, but there may still be something to read on another part. * Superfluous semicolons. * Code for MS-Windows is complicated because of the exceptions for old systems. * Mouse mode is not automatically detected for tmux. * After ":bwipeout" 'fileformat' is not set to the right default.- Updated to revision 3, fixes the following problems * getwinvar() returns wrong Value of boolean and number options, especially non big endian systems. (James McCoy)- Updated to revision 2, fixes the following problems * Intro screen still mentions version7. (Paul) * The netrw plugin does not work.- Update to version 8.0 * Crash on exit when EXITFREE is defined. (Dominique Pelle) * Valgrind reports using uninitialzed memory. (Dominique Pelle) * Test 86 and 87 fail with some version of Python. * Netbeans test fails when run from unpacked MS-Windows sources. * Netbeans test fails in shadow directory. * Not enough test coverage for Normal mode commands. * The example that explains nested backreferences does not work properly with the new regexp engine. (Harm te Hennepe) * Regexp fails to match when using "\>\)\?". (Ramel) * Reading past end of line when using previous substitute pattern. (Dominique Pelle) * Attempt to read history entry while not initialized. * Compiler warnings with Solaris Studio when using GTK3. * Memory leak in timer_start(). * Invalid memory access when formatting. (Dominique Pelle) * Checking for last_timer_id to overflow is not reliable. (Ozaki Kiichi) * Illegal memory access with ":1@". (Dominique Pelle) * Superfluous function prototypes. * Sort test sometimes fails. * Needless line break. Confusing directory name. * MS-Windows gvim.exe does not have DirectX support. * Test runner misses a comma.- Updated to revision 2347, fixes the following problems * submatch() does not check for a valid argument. * The 'langnoremap' option leads to double negatives. And it does not work for the last character of a mapping. * Can't use "." and "$" with ":tab". * With SGR mouse reporting (suckless terminal) the mouse release and scroll up/down is confused. * Warning for missing declaration of skip_vimgrep_pat(). (John Marriott) * Tests using the sleep time can be flaky. * Timer test sometimes fails. * Timer test sometimes fails. * Warning for assigning negative value to unsigned. (Danek Duvall) * Adding pattern to ":oldfiles" is not a generic solution. * Filter test fails. * Oldfiles test fails. * Tiny build fails. (Tony Mechelynck) * When cancelling the :ptjump prompt a preview window is opened for a following command. * Missing colon in error message. * Some error message cannot be translated. * In rare cases diffing 4 buffers is not enough. * Compiler warnings for signed/unsigned in expression. * Check for Windows 3.1 will always return false. (Christian Brabandt) * Compiler warnings in MzScheme code. * The script that checks translations can't handle plurals. * Coverity complains about null pointer check. * Coverity complains about not checking for NULL. * Two JSON messages are sent without a separator. * With 'incsearch' can only see the next match. * Channel test is flaky. * Build fails with small features. * Fail to read register content from viminfo if it is 438 characters long. (John Chen) * :filter does not work for many commands. Can only get matching messages. * When adding entries to an empty quickfix list the title is reset. * printf() isn't tested much. * printf() test fails on Windows. "-inf" is not used. * Build fails on MS-Windows. * Using CTRL-N and CTRL-P for incsearch shadows completion keys. * Using 'hlsearch' highlighting instead of matchpos if there is no search match. * Insufficient testing for NUL bytes on a raw channel. * Netbeans test doesn't read settings from file. * getbufinfo(), getwininfo() and gettabinfo() are inefficient. * getwininfo() and getbufinfo() are inefficient. * Command line completion on "find **/filename" drops sub-directory. * ":diffoff!" does not remove filler lines. * Command line test fails on Windows when run twice. * Memory leak in getbufinfo() when there is a sign. (Dominique Pelle) * New users have no idea of the 'scrolloff' option. * Starting diff mode with the cursor in the last line might end up only showing one closed fold. (John Beckett) * printf() doesn't handle infinity float values correctly. * Timer test fails sometimes. * When a child process is very fast waiting 10 msec for it is noticeable. (Ramel Eshed) * Part of ":oldfiles" command isn't cleared. (Lifepillar) * Comment in scope header file is outdated. (KillTheMule) * Generated files are outdated. * The tee program isn't included. Makefile contains build instructions that don't work. * The callback passed to ch_sendraw() is not used. * MS-Windows build instructions are clumsy. "dosbin" doesn't build. * When installing and $DESTDIR is set the icons probably won't be installed. * Compiler warning in tiny build. (Tony Mechelynck) * printf() handles floats wrong when there is a sign. * Not all systems understand %F in printf(). * Modelines in source code are inconsistent. * Sign test fails on MS-Windows when using the distributed zip archives. * Cscope test fails. * No tests for :undolist and "U" command. * When starting a job that reads from a buffer and reaching the end, the job hangs. * It is not possible to close the "in" part of a channel. * QuickFixCmdPre and QuickFixCmdPost autocommands are not always triggered. * Get warning for deleting autocommand group when the autocommand using the group is scheduled for deletion. (Pavol Juhas) * MS-Windows: some files remain after testing. * Default interface versions for MS-Windows are outdated. * When using "is" the mode isn't always updated. * In a timer callback the timer itself can't be found or stopped. (Thinca) * Marks, writefile and nested function tests are old style. * Default value for 'langremap' is wrong. * Several tests are old style. * Old charsearch test still listed in Makefile. * Crash when doing tabnext in a BufUnload autocmd. (Dominique Pelle) * Accessing freed memory when a timer does not repeat. * Appveyor 64 bit build still using Python 3.4 * Crash when autocommand moves to another tab. (Dominique Pelle) * Crash when deleting an augroup and listing an autocommand. (Dominique Pelle) * No error when deleting an augroup while it's the current one. * Insufficient testing for Normal mode commands. * Channel sort test is flaky. * Normal mode tests fail on MS-Windows. * When 'incsearch' is not set CTRL-T and CTRL-G are not inserted as before. * No way for a system wide vimrc to stop loading defaults.vim. (Christian Hesse) * Redraw problem when using 'incsearch'. * When a test is commented out we forget about it. * Access memory beyond the end of the line. (Dominique Pelle) * Using freed memory when using 'formatexpr'. (Dominique Pelle) * Crash when editing a new buffer and BufUnload autocommand wipes out the new buffer. (Norio Takagi) * Tiny build fails. * Illegal memory access when Visual selection starts in invalid position. (Dominique Pelle) * Freeing a variable that is on the stack. * Crash when BufWinLeave autocmd goes to another tab page. (Hirohito Higashi) * Error for min() and max() contains %s. (Nikolay Pavlov) * Coverity complains about not checking curwin to be NULL. * Using CTRL-X CTRL-V to complete a command line from Insert mode does not work after entering an expression on the command line. * Crash when stop_timer() is called in a callback of a callback. Vim hangs when the timer callback uses too much time. * Outdated comments in test. * On MS-Windows test_getcwd leaves Xtopdir behind. * taglist() is slow. (Luc Hermitte) * Running normal mode tests leave a couple of files behind. (Yegappan Lakshmanan) * taglist() is still slow. (Luc Hermitte) * Can't build with small features. (John Marriott) * Tab page test fails when run as fake root. * MS-Windows: Building with Ruby uses old version. * Tiny things. Test doesn't clean up properly. * Typo in MS-Windows build script. * Too many old style tests. * The "Reading from channel output..." message can be unwanted. Appending to a buffer leaves an empty first line behind. * For MinGW RUBY_API_VER_LONG isn't set correctly. Many default version numbers are outdated. * Autocommand test fails when run directly, passes when run as part of test_alot.- Updated to revision 2334, fixes the following problems * No tests for :undolist and "U" command. * When starting a job that reads from a buffer and reaching the end, the job hangs. * It is not possible to close the "in" part of a channel. * QuickFixCmdPre and QuickFixCmdPost autocommands are not always triggered. * Get warning for deleting autocommand group when the autocommand using the group is scheduled for deletion. (Pavol Juhas) * MS-Windows: some files remain after testing. * Default interface versions for MS-Windows are outdated. * When using "is" the mode isn't always updated. * In a timer callback the timer itself can't be found or stopped. (Thinca) * Marks, writefile and nested function tests are old style. * Default value for 'langremap' is wrong. * Several tests are old style. * Old charsearch test still listed in Makefile. * Crash when doing tabnext in a BufUnload autocmd. (Dominique Pelle) * Accessing freed memory when a timer does not repeat. * Appveyor 64 bit build still using Python 3.4 * Crash when autocommand moves to another tab. (Dominique Pelle) * Crash when deleting an augroup and listing an autocommand. (Dominique Pelle) * No error when deleting an augroup while it's the current one. * Insufficient testing for Normal mode commands. * Channel sort test is flaky. * Normal mode tests fail on MS-Windows. * When 'incsearch' is not set CTRL-T and CTRL-G are not inserted as before. * No way for a system wide vimrc to stop loading defaults.vim. (Christian Hesse) * Redraw problem when using 'incsearch'. * When a test is commented out we forget about it. * Access memory beyond the end of the line. (Dominique Pelle) * Using freed memory when using 'formatexpr'. (Dominique Pelle) * Crash when editing a new buffer and BufUnload autocommand wipes out the new buffer. (Norio Takagi) * Tiny build fails. * Illegal memory access when Visual selection starts in invalid position. (Dominique Pelle) * Freeing a variable that is on the stack. * Crash when BufWinLeave autocmd goes to another tab page. (Hirohito Higashi) * Error for min() and max() contains %s. (Nikolay Pavlov) * Coverity complains about not checking curwin to be NULL. * Using CTRL-X CTRL-V to complete a command line from Insert mode does not work after entering an expression on the command line. * Crash when stop_timer() is called in a callback of a callback. Vim hangs when the timer callback uses too much time. * Outdated comments in test. * On MS-Windows test_getcwd leaves Xtopdir behind.- Updated to revision 2295, fixes the following problems * The field names used by getbufinfo(), gettabinfo() and getwininfo() are not consistent. * Tab page tests are old style. * Test files have inconsistant modelines. * Startup test fails on Solaris. * There is no equivalent of 'smartcase' for a tag search. * ":oldfiles" output is a very long list. * The default ttimeoutlen is very long. * Crash when using funcref() with invalid name. (Dominique Pelle) * Can't build with +eval but without +quickfix. (John Marriott) * submatch() does not check for a valid argument. * The 'langnoremap' option leads to double negatives. And it does not work for the last character of a mapping. * Can't use "." and "$" with ":tab". * With SGR mouse reporting (suckless terminal) the mouse release and scroll up/down is confused. * Warning for missing declaration of skip_vimgrep_pat(). (John Marriott) * Tests using the sleep time can be flaky. * Timer test sometimes fails. * Timer test sometimes fails. * Warning for assigning negative value to unsigned. (Danek Duvall) * Adding pattern to ":oldfiles" is not a generic solution. * Filter test fails. * Oldfiles test fails. * Tiny build fails. (Tony Mechelynck) * When cancelling the :ptjump prompt a preview window is opened for a following command. * Missing colon in error message. * Some error message cannot be translated. * In rare cases diffing 4 buffers is not enough. * Compiler warnings for signed/unsigned in expression. * Check for Windows 3.1 will always return false. (Christian Brabandt) * Compiler warnings in MzScheme code. * The script that checks translations can't handle plurals. * Coverity complains about null pointer check. * Coverity complains about not checking for NULL. * Two JSON messages are sent without a separator. * With 'incsearch' can only see the next match. * Channel test is flaky. * Build fails with small features. * Fail to read register content from viminfo if it is 438 characters long. (John Chen) * :filter does not work for many commands. Can only get matching messages. * When adding entries to an empty quickfix list the title is reset. * printf() isn't tested much. * printf() test fails on Windows. "-inf" is not used. * Build fails on MS-Windows. * Using CTRL-N and CTRL-P for incsearch shadows completion keys. * Using 'hlsearch' highlighting instead of matchpos if there is no search match. * Insufficient testing for NUL bytes on a raw channel. * Netbeans test doesn't read settings from file. * getbufinfo(), getwininfo() and gettabinfo() are inefficient. * getwininfo() and getbufinfo() are inefficient. * Command line completion on "find **/filename" drops sub-directory. * ":diffoff!" does not remove filler lines. * Command line test fails on Windows when run twice. * Memory leak in getbufinfo() when there is a sign. (Dominique Pelle) * New users have no idea of the 'scrolloff' option. * Starting diff mode with the cursor in the last line might end up only showing one closed fold. (John Beckett) * printf() doesn't handle infinity float values correctly. * Timer test fails sometimes. * When a child process is very fast waiting 10 msec for it is noticeable. (Ramel Eshed) * Part of ":oldfiles" command isn't cleared. (Lifepillar) * Comment in scope header file is outdated. (KillTheMule) * Generated files are outdated. * The tee program isn't included. Makefile contains build instructions that don't work. * The callback passed to ch_sendraw() is not used. * MS-Windows build instructions are clumsy. "dosbin" doesn't build. * When installing and $DESTDIR is set the icons probably won't be installed. * Compiler warning in tiny build. (Tony Mechelynck) * printf() handles floats wrong when there is a sign. * Not all systems understand %F in printf(). * Modelines in source code are inconsistent. * Sign test fails on MS-Windows when using the distributed zip archives. * Cscope test fails.- Updated to revision 2225, fixes the following problems * When using matchaddpos() a character after the end of the line can be highlighted. * Can't build with +timers when +digraph is not included. * Recursive call to substitute gets stuck in sandbox. * printf() gives an error when the argument for %s is not a string. * printf() does not support binary format. * Sourcing a script where a character has 0x80 as a second byte does not work. * Buffer overflow when using latin1 character with feedkeys(). * Compiler warnings with older compiler and 64 bit numbers. * Crash when placing a sign in a deleted buffer.- Updated to revision 2216, fixes the following problems * The qf_init_ext() function is too big. * Compiler warning for initializing a struct. * There is still code and help for unsupported systems. * There is no way to get a list of the error lists. * When using ":vimgrep" may end up with duplicate buffers. * No proper testing of trunc_string(). * Coverage report is messed up by the unittests. * Can't run scripttests in the top directory. * Wrong part of #ifdef removed. * eval.c is too big. * Build fails. * eval.c is too big. * eval.c is too big. * Non-Unix builds fail. * Wrong file name. * qf_init_ext() is too big. * Using dummy variable to compute struct member offset. * eval.c is still too big. * Coverity warns for possible buffer overflow. * Compiler warns for uninitialzed variable. (John Marriott) * getcompletion() not well tested. * Compiler warning for char/char_u conversion. * Not all arguments of trunc_string() are tested. Memory access error when running the message tests. * spell.c is too big. * Missing change to include file. * The return value of type() is difficult to use. * substitute() does not support a Funcref argument. * rgb.txt is read for every color name. * One more place using a dummy variable. * No autocommand event to initialize a window or tab page. * Syntax error when dict has '>' key. * Cannot update 'tabline' when a tab was closed. * Running checks in po diretory fails. * Netbeans test fails on non-Unix systems. * When using PERROR() on some systems assert_fails() does not see the error. * Line numbers in the error list are not always adjusted. * Not much test coverage for digraphs. * Coverity complains about not restoring a value. * New digraph test makes testing hang. * Digraph tests fails on some systems. * Using the system default encoding makes tests unpredictable. * Digraph code test coverage is still low. * Keymap test fails with normal features. * Color handling of X11 GUIs is too complicated. * Using submatch() in a lambda passed to substitute() is verbose. * Coverity reports a resource leak when out of memory. * GTK 3 build fails with older GTK version. * Netbeans test fails once in a while. Leaving log file behind. * The color allocation in X11 is overly complicated. * Man test fails when run with the GUI. * Lambda functions show up with completion. * Warning from 64 bit compiler. * Text object tests are old style. * When a keymap is active only "(lang)" is displayed. * "cgn" and "dgn" do not work correctly with a single character match and the replacement includes the searched pattern. * Looping over windows, buffers and tab pages is inconsistant. * Tiny build with GUI fails. * Can't have "augroup END" right after ":au!". * Code duplication when unreferencing a function. * Configure reports default features to be "normal" while it is "huge". * Clang warns about missing field in initializer. * Misplaced equal sign. * Netbeans test is flaky. * Setting 'display' to "lastline" is a drastic change, while omitting it results in lots of "@" lines. * When there is an CmdUndefined autocmd then the error for a missing command is E464 instead of E492. (Manuel Ortega) * Defaults are very conservative. * getcompletion(.., 'dir') returns a match with trailing "*" when there are no matches. * Test for undo is flaky. * Tiny build fails. * Loading defaults.vim with -C argument. * The default vimrc for Windows is very conservative. * Deleting an augroup that still has autocmds does not give a warning. The next defined augroup takes its place. * Mac: can't build with tiny features. * Closures are not supported. * User defined functions can't be a closure. * No easy way to check if lambda and closure are supported. * Mac: don't get +clipboard in huge build. * No new style test for diff mode. * diffmode test leaves files behind, breaking another test. * Compiler warning for loss of data. * No tests for :diffget and :diffput * The short form of ":noswapfile" is ":noswap" instead of ":nos". * Memory leak when saving for undo fails. * Memory leak when using timer_start(). (Dominique Pelle) * Pending timers cause false memory leak reports. * More memory leaks when using partial, e.g. for "exit-cb". * test_partial has memory leaks reported. * Can't build with tiny features. * No error for using function() badly. * Various tiny issues. * Closure function fails. * Using function() with a name will find another function when it is redefined. * Test 86 and 87 fail. * :delfunction causes illegal memory access. * Tiny build fails. * Coverity reports bogus NULL check. * Leaking memory when redefining a function. * A funccal is garbage collected while it can still be used. * On MS-Windows quickix does not handle a line with 1023 bytes ending in CR-LF properly. * Win32: Using CreateThread/ExitThread is not safe. * Not enough testing for popup menu. CTRL-E does not always work properly. * test_alot fails. * Not much testing for cscope. * If a test leaves a window open a following test may fail. * Warning with MinGW 64. (John Marriott) * Quickfix test fails on MS-Windows. * No proper translation of messages with a count. * GUI test isn't testing much. * Test_communicate() fails sometimes. * Quotes make GUI test fail on MS-Windows. * Compiler warning. * Test_job_start_fails() is expected to report memory leaks, making it hard to see other leaks in test_partial. * Result of getcompletion('', 'cscope') depends on previous completion. * Insufficient testing for cscope. * setmatches() mixes up values. (Nikolai Pavlov) * Expression test fails without conceal feature. * Result of getcompletion('', 'sign') depends on previous completion. * match() and related functions tested with old style test. * It is not possible to use plugins in an "after" directory to tune the behavior of a package. * Startup test fails on MS-Windows. * Small build can't run startup test. * Small build can't run tests. * Not running the startup test on MS-Windows. * Startup test gets stuck on MS-Windows. * Cannot get information about timers. * MS-Windows build fails. * No test for "vim --help". * Can't test help on MS-Windows. * Adding duplicate flags to 'whichwrap' leaves commas behind. * Insufficient testing of cscope. * #ifdefs in main() are complicated. * No testing for -C and -N command line flags, file arguments, startuptime. * No test for reading from stdin. * Reading from stdin test fails on MS-Windows. * There is no easy way to stop all timers. There is no way to temporary pause a timer. * Compiler warning for unused variable. * Color Grey40 used in startup but not in the short list. * Sign tests are old style. * Tests that use RunVim() do not actually perform the test. * Test glob2regpat does not test much. * Timers test is flaky. * glob2regpat test fails on Windows. * Completion does not work properly with some plugins. * Cannot detect encoding in a fifo. * When startup test fails it's not easy to find out why. GUI test fails with Gnome. * No automatic prototype for vim_main2(). * Generating prototypes with Cygwin doesn't work well. * With Gnome when the GUI can't start test_startup hangs. * Sign tests don't cover enough. * MS-Windows: The vimrun program does not support Unicode. * glob2regpat test doesn't test everything on MS-Windows. * All functions are freed on exit, which may hide leaks. * Test alot sometimes fails under valgrind. (Dominique Pelle) * In the GUI the cursor is hidden when redrawing any window, causing flicker. * Cannot get all information about a quickfix list. * The sign column disappears when the last sign is deleted. * Build fails with small features. * Test fails with normal features. * It is not easy to get information about buffers, windows and tabpages. * 'wildignore' always applies to getcompletion(). * Warning for unused function. * The +xpm feature is not sorted properly in :version output. * Test for mappings is old style. * Cannot map . (Stephen Riehm) * On OSX configure mixes up a Python framework and the Unix layout. * Mouse support is not automatically enabled with simple term. * Mark " is not set when closing a window in another tab. (Guraga) * Cannot highlight the "~" lines at the end of a window differently. * A font that uses ligatures messes up the screen display. * It's not easy to find out if a window is a quickfix or location list window. * Test fails without the +sign feature.- Updated to revision 2045, fixes the following problems * Looking up a buffer by number is slow if there are many. * Netbeans file authentication not tested. * GTK: display updating is not done properly and can be slow. * setbufvar() causes a screen redraw. * filter() and map() either require a string or defining a function. * Memory leak when using a function callback.- Updated to revision 2033, fixes the following problems * Memory access error when reading viminfo. (Dominique Pelle) * "gd" hangs in some situations. (Eric Biggers) * Not all quickfix tests are also done with the location lists. * Background is not drawn properly when 'termguicolors' is set. * Coverity warns for unreachable code. * Win32: Cannot compile with XPM feature using VC2015 * The Man plugin doesn't work that well. * File list does not include new XPM libraries. * Viminfo continuation line with wrong length isn't skipped. (Marius Gedminas) * Using Ctrl-A with double-byte encoding may result in garbled text. * Minor problems with the quickfix code. * Quickfix long lines test not executed for buffer. * Ruby test is old style. * Cscope interface does not support finding assignments. * Not all parts of the quickfix code are tested. * No test for what 7.4.1948 fixes. * Using 32-bit Perl with 64-bit time_t causes memory corruption. (Christian Brabandt) * When using CTRL-W f and pressing "q" at the ATTENTION dialog the newly opened window is not closed. * Perl interface has obsolete workaround. * Perl interface preprocessor statements not nicely indented. * Crash when running test_channel.vim on Windows. * Unicode standard 9 was released. * When 'insertmode' is reset while doing completion the popup menu remains even though Vim is in Normal mode. * Two test files for increment/decrement. * Running Win32 Vim in mintty does not work. * The quickfix init function is too big. * When using a job in raw mode to append to a buffer garbage characters are added. * Coverity reports a resource leak. * Falling back from NFA to old regexp engine does not work properly. (fritzophrenic) * Invalid memory access with "\. * When the netbeans channel is closed consuming the buffer may cause a crash. * Using ":insert" in an empty buffer sets the jump mark. (Ingo Karkat) * It is not easy to see unrecognized error lines below the current error position. * On Solaris select() does not work as expected when there is typeahead. * GUI has a problem with some termcodes. * On MS-Windows large files (> 2Gbyte) cause problems. * Number variables are not 64 bits while they could be. * With 64 bit changes don't need three calls to sprintf(). * Large file test does not delete its output. * Getting value of binary option is wrong. (Kent Sibilev) * 'errorformat' is parsed for every call to ":caddexpr". Can't add to two location lists asynchronously. * No testing for Farsi code. * Viminfo file contains duplicate change marks. * farsi.c and arabic.c are included in a strange way. * Not all quickfix features are tested. * Missing changes in VMS build file. * Compiler warns for loss of data. * When copying unrecognized lines for viminfo, end up with useless continuation lines. * When updating viminfo with file marks there is no time order. * filter() and map() only accept a string argument. * Cscope items are not sorted. * glob() does not add a symbolic link when there are no wildcards. * Values for true and false can be confusing. * Not all TRUE and FALSE arguments are tested. * True-false test fails. * GUI: cursor drawn in wrong place if a timer callback causes a screen update. (David Samvelyan) * Capturing the output of a command takes a few commands. * Cannot easily scroll the quickfix window. * When writing buffer lines to a job there is no NL to NUL conversion. * evalcmd() doesn't work recursively. * Evalcmd test fails. * Tiny build fails. (Tony Mechelynck) * Crash when passing number to filter() or map(). * Still cursor flickering when a callback updates the screen. (David Samvelyan) * GUI: cursor displayed in the wrong position. * After using evalcmd() message output is in the wrong position. (Christian Brabandt) * Crash when using tabnext in BufUnload autocmd. (Norio Takagi) * Running the tests leaves a viminfo file behind. * evalcmd() has a confusing name. * Messages test fails. * There is a :cbottom command but no :lbottom command. * It is not easy to get a list of command arguments. * Test for getcompletion() does not pass on all systems. * Using "noinsert" in 'completeopt' breaks redo. * Using "noinsert" in 'completeopt' does not insert match. * When a file gets a name when writing it 'acd' is not effective. (Dan Church) * Warning from MinGW about _WIN32_WINNT redefined. (John Marriott) * When there are many errors adding them to the quickfix list takes a long time. * buf_valid() can be slow when there are many buffers. * When ignoring case utf_fold() may consume a lot of time. * Can't build without +autocmd feature. * Still too many buf_valid() calls. * Warnings from 64 bit compiler. * buflist_findname_stat() may find a dummy buffer. * More buf_valid() calls can be optimized. * The cursor blinking stops or is irregular when receiving date over a channel and writing it in a buffer, and when updating the status. * Reference counting for callbacks isn't right. * Can't build with +eval but without +menu. * cppcheck warns for using index before limits check. * printf() does not work with 64 bit numbers. * ARCH must be set properly when using MinGW. * The list_lbr_utf8 test fails if ~/.vim/syntax/c.vim sets 'textwidth' to a non-zero value. * Build fails with 64 bit MinGW. (Axel Bender) * 'cscopequickfix' option does not accept new value "a".- Updated to revision 1938, fixes the following problems * Updating marks in a quickfix list is very slow when the list is long. * When waiting for a character is interrupted by receiving channel data and the first character of a mapping was typed, the mapping times out. * When receiving channel data 'updatetime' is not respected. * Wrong computation of remaining wait time in RealWaitForChar() * When umask is set to 0177 Vim can't create temp files. * GUI: When channel data is received the cursor blinking is interrupted. * Channel reading very long lines is slow. * balloon eval only gets the window number, not the ID. * Cannot easily get the window ID for a buffer. * Cannot get the window ID for a mouse click. * Cannot use a window ID where a window number is expected. * Invoking mark_adjust() when adding a new line below the last line is pointless. * Various typos, long lines and style mistakes. * User commands don't support modifiers. * GTK 3: cursor blinking doesn't work well. * Using CTRL-] in the help on "{address}." doesn't work. * Win32: the "Disabled" menu items would appear enabled. * No test for collapsing buffers for a channel. Some text is lost. * When writing viminfo merging current history with history in viminfo may drop recent history entries. * Some compilers can't handle a double semicolon. * Collapsing channel buffers and searching for NL does not work properly. * Warnings from 64 bit compiler. * Netbeans uses uninitialzed pointer and freed memory. * Doubled semicolons. * Tests using external command to delete directory. * Recent history lines may be lost when exiting Vim. * No test for using setqflist() on an older quickfix list. * When ":doautocmd" is used modelines are used even when no autocommands were executed. * Executing autocommands while using the signal stack has a high chance of crashing Vim. * The effect of the PopupMenu autocommand isn't directly visible. * No proper test for what 7.4.1906 fixes. * History lines read from viminfo in different encoding than when writing are not converted. * Not enough testing for parsing viminfo lines. * Register contents is not merged when writing viminfo. * Missing test changes. * vim_time() not included when needed. * Ruby 2.4.0 unifies Fixnum and Bignum into Integer. * Command line editing is not tested much. * Missing "void" for functions without argument. * Viminfo does not merge file marks properly. * Possible crash with many history items. * Compiler warning for signed/unsigned. * Overwriting pointer argument. * Inconsistent indenting and weird name. * Can't build without +spell but with +quickfix. * Using both old and new style file mark lines from viminfo. * When writing viminfo the jumplist is not merged with the one in the viminfo file. * Compiler warning about uninitialzed variable. * New style tests not executed with MinGW compiler. * When using the GUI search/replace a second match right after the replacement is skipped. * Off-by-one error in bounds check. * No test for directory stack in quickfix. * When writing viminfo numbered marks were duplicated. - Refresh vim-7.3-filetype_spec.patch- Link to perl directly instead of dlopen'ing it.- vim must require %{?libperl_requires}, if perl is not updated with vim in lockstep, the following error occurs: vim: error while loading shared libraries: libperl.so and the program stops working. (boo#982869)- Updated to revision 1883, fixes the following problems * Python: encoding error with Python 2. * Memory leaks in test49. * Invalid memory access when exiting with EXITFREE defined. * Memory leak in test_matchstrpos. * Setting really_exiting causes memory leaks to be reported. * Appending to the quickfix list while the quickfix window is open is very slow. * When a callback adds a timer the GUI doesn't use it until later. * Comparing functions and partials doesn't work well. * Typing "k" at the hit-enter prompt has no effect. * Whether a job has exited isn't detected until a character is typed. After calling exit_cb the cursor is in the wrong place. * Channel test is flaky. * Appending to a long quickfix list is slow. * Check for line break at end of line wrong. * Cppcheck found 2 incorrect printf formats.- Updated to revision 1862, fixes the following problems * Using a partial for timer_start() may cause a crash. * Compiler warnings with 64 bit compiler. * string() with repeated argument does not give a result usable by eval().- Updated to revision 1859, fixes the following problems * Tests involving Python are flaky. * Ubsan detects a multiplication overflow. * Getting an item from a NULL dict crashes. * Can't build with Strawberry Perl 5.24 (obsoletes perl-5.24.patch) * Still trying to read from channel that is going to be closed. * GUI freezes when using a job. * test_syn_attr fails when using the GUI. * Unix: Cannot run all tests with the GUI. * Crash when job and channel are in the same dict while using partials. * When setting 'termguicolors' the Ignore highlighting doesn't work. * Valgrind reports memory leak for job that is not freed. * When a channel appends to a buffer that is 'nomodifiable' there is an error but appending is done anyway. * When a channel writes to a buffer it doesn't find a buffer by the short name but re-uses it anyway. * Cannot use a function reference for "exit_cb".- Update apparmor.vim (taken from AppArmor 2.10.1) * add support for the "unspec" network keyword- Updated to revision 1842, fixes the following problems * non-antialiased misnamed. * When timer_stop() is called with a string there is no proper error message. * Memory leak in debug commands. * Cannot use an Ex command for 'keywordprg'. * Possible crash when conceal is active. * When splitting and closing a window the status height changes. * When using a partial on a dictionary it always gets bound to that dictionary. * The BufUnload event is triggered twice, when :bunload is used with `bufhidden` set to `unload` or `delete`. * Functions specifically for testing do not sort together. * Cannot get the items stored in a partial. * When using packages an "after" directory cannot be used. * The code to reallocate the buffer used for quickfix is repeated. * get() works for Partial but not for Funcref.- Fix build with perl 5.24 (perl-5.24.patch)- Updated to revision 1829, fixes the following problems * No error when invoking a callback when it's not safe. * May try to access buffer that's already freed. * No message on channel log when buffer was freed.- Updated to revision 1826, fixes the following problems * The screen is not updated if a callback is invoked when closing a channel. * Help completion adds @en to all matches except the first one. * Compiler warnings when sprintf() is a macro. * Removing language from help tags too often. * Redirecting stdout of a channel to "null" doesn't work. * When a job is no longer referenced and does not have an exit callback the process may hang around in defunc state. * When job writes to buffer nothing is written. * Callbacks are invoked when it's not safe.- Updated to revision 1816, fixes the following problems * 'guicolors' is a confusing option name. * Quickfix doesn't handle long lines well, they are split. * GTK3 doesn't handle menu separaters properly. * Can't use Vim as MANPAGER. * Running tests in shadow dir fails. * 'termguicolors' option missing from the options window. * Test_out_close_cb sometimes fails. * Using wrong feature name to check for 'termguicolors'. * Using wrong short option name for 'termguicolors'. * Sending DETACH after a channel was closed isn't useful. * Netbeans channel gets garbage collected. * Memory access error when running test_quickfix. * A channel may be garbage collected while it's still being used by a job. * Looping over a null list throws an error. - Refresh vim-7.4-filetype_mine.patch- Updated to revision 1796, fixes the following problems * Cannot use ch_read() in the close callback. * Leading white space in a job command matters. * Channel could be garbage collected too early. * Color name decoding is implemented several times. * Some character classes may differ between systems.- Updated to revision 1786, fixes the following problems * When using the term truecolor feature, the t_8f and t_8b termcap options are not set by default. * Using negative index in strcharpart(). * Warnings reported by cppcheck. * synIDattr() does not respect 'guicolors'. * strcharpart() does not work properly with some multi-byte characters. * The old regexp engine doesn't handle character classes correctly. * Compiled-in colors do not match rgb.txt.- Updated to revision 1778, fixes the following problems * When using complete() it may set 'modified' even though nothing was inserted. * When using feedkeys() in a timer the inserted characters are not used right away. * Undo options are not together in the options window. * Arguments of setqflist() are not checked properly. * No "closed", "errors" and "encoding" attribute on Python output. * Cannot use true color in the terminal. * Newly added features can escape the sandbox. * When using the term truecolor feature, the t_8f and t_8b termcap options are not set by default.- Updated to revision 1754, fixes the following problems * When a buffer gets updated while in command line mode, the screen may be messed up. * Crash when 'tagstack' is off. (Dominique Pelle) * When adding to the quickfix list the current position is reset. * "noinsert" in 'completeopt' is sometimes ignored * syntax not set when using ":buf" and 'filetype' set manually- Updated to revision 1749, fixes the following problems * Cannot detect a crash in tests when caused by garbagecollect(). * The help for functions require a space after the "(". * The Perl interface cannot use 'print' operator for writing directly in standard IO. * It is not easy to get a character out of a string. * Python: turns partial into simple funcref. * Folds may close when using autocomplete. * Test fails when not using utf-8. * It is not possible to only see part of the message history. It is not possible to clear messages. * Count for ":messages" depends on number of lines. * syn-cchar defined with matchadd() does not appear if there are no other syntax definitions which matches buffer text. * Not testing utf-8 characters. * strgetchar() does not work correctly. * Clang warns for uninitialzed variable. (Michael Jarvis) * Python: Converting a sequence may leak memory. * Memory leak in Perl. * Coverity: missing check for NULL pointer. * "gD" does not find match in first column of first line. * When using GTK 3.20 there are a few warnings.- Updated to revision 1726, fixes the following problems * Crash when calling garbagecollect() after starting a job. * When using try/catch in 'tabline' it is still considered an error and the tabline will be disabled. * Tabline test fails in GUI. * Compiler errors for non-ANSI compilers. * ANSI compiler complains about string length.- Updated to revision 1721, fixes the following problems * Leaking memory when opening a channel fails. * Coverity: not using return value of set_ref_in_item(). * Leaking memory when there is a cycle involving a job and a partial. * Tests fail without the job feature.- Updated to revision 1716, fixes the following problems * When using try/catch in 'statusline' it is still considered an error and the status line will be disabled. * For plugins in packages, plugin authors need to take care of all dependencies. * GTK GUI doesn't work on Wayland. * Non-GUI specific settings in the gvimrc_example file. * Double free when a partial is in a cycle with a list or dict. * 'autochdir' doesn't work for the first file.- Updated to revision 1710, fixes the following problems * feedkeys('i', 'x') gets stuck, waits for a character to be typed. * Building the Perl interface gives compiler warnings. * ":syn reset" clears the effect ":syn iskeyword". (James McCoy) * When using :stopinsert in a silent mapping the "INSERT" message isn't cleared. * Display problems when the 'ambiwidth' and 'emoji' options are not set properly or the terminal doesn't behave as expected. * :packadd does not work the same when used early or late. * Using freed memory when parsing 'printoptions' fails. * Using freed memory with "wincmd p". (Dominique Pelle) * Cannot use empty dictionary key, even though it can be useful. * New regexp engine does not work properly with EBCDIC. * Not all output of an external command is read.- Updated to revision 1691, fixes the following problems * When reading JSON from a channel all readahead is used. * channel_get_all() does multiple allocations. * When writing buffer lines to a pipe Vim may block. * Completion doesn't work well for a variable containing "#". * When help exists in multiple languages, adding @ab while "ab" is the default help language is unnecessary. * The Dvorak support is a bit difficult to install. * The justify plugin has to be copied or sourced to be used. * The editexisting plugin has to be copied or sourced to be used. * The swapmous plugin has to be copied or sourced to be used. * The shellmenu plugin has to be copied or sourced to be used. * A reference to the removed file_select plugin remains. * Coverity: copying value of v_lock without initializing it. * Coverity warns for not checking name length (false positive). * Coverity warns for fixed size buffer length (false positive). * Coverity: no check for NULL. * README text is slightly outdated. * There is no easy way to get all the information about a match. * When running tests $HOME/.viminfo is written. * The channel close_cb option does not work. * MzScheme does not support partial. * Ruby interface has inconsistent coding style. * Can't compile with the conceal feature but without multi-byte. * When switching to a new buffer and an autocommand applies syntax highlighting an ml_get error may occur.- Updated to revision 1665, fixes the following problems * When 'F' is in 'shortmess' the prompt for the encryption key isn't displayed. * When binding a function to a dict the reference count is wrong. * Invoking garbage collection may cause a double free. * Crash when an autocommand changes a quickfix list. * Handling emoji characters as full width has problems with backwards compatibility. * Terminating file name has side effects. * Using string() on a partial that exists in the dictionary it binds results in an error. * When a dict contains a partial it can't be redefined as a function. * Using Python vim.bindeval() on a partial doesn't work. * Using freed memory after setqflist() and ":caddbuffer". * Compiler has a problem copying a string into di_key[]. * The matchit plugin needs to be copied to be used. * Quickfix test fails. * Old style test for fnamemodify(). * Users who loaded matchit.vim manually have to change their startup. * Crash when using expand('%:S') in a buffer without a name. * remote_expr() hangs. * Crash when using partial with a timer. * On Unix in a terminal: channel messages are not handled right away. * A plugin does not know when VimEnter autocommands were already triggered. * has('patch-7.4.1') doesn't work. * No test for special characters in channel eval command. * No test for an invalid Ex command on a channel. * Crash in :cgetexpr. * Crash when calling job_start() with a NULL string.- Updated to revision 1635, fixes the following problems * Quickfix code using memory after being freed. * Using channel timeout instead of request timeout. * Timers don't work on Unix. * Not checking for failed open(). * Memory leak when out of memory. * When starting the GUI fails a swap file is left behind. * Timer with an ":echo" command messes up display. * Although emoji characters are ambiguous width, best is to treat them as full width. * Catching exception that won't be thrown. * Having type() handle a Funcref that is or isn't a partial differently causes problems for existing scripts. * Comparing a function that exists on two dicts is not backwards compatible. * string() doesn't handle a partial. * Contents file is only for Amiga distro. * Compiler warnings for non-virtual destructor. * The versplit feature makes the code uneccessary complicated. * Can't build with small features. * Still can't build with small features. * Still quickfix test in old style. * Build fails with tiny features. * Malformed channel request causes a hang. * When a JSON message is split it isn't decoded. * Starting job with output to buffer changes options in the current buffer. * When 'fileformats' is set in the vimrc it applies to new buffers but not the initial buffer. * Emoji characters are not considered as a kind of word character. * Channel test doesn't work with Python 2.6. * Channel demo doesn't work with Python 2.6. * All Channels share the message ID, it keeps getting bigger. * Can't get info about a channel. * Trying to close file descriptor that isn't open. * Missing changes to structs. * Channel out_cb and err_cb are not tested. * 64-bit Compiler warning. * Handling emoji characters as full width has problems with backwards compatibility. * Unicode table for double width is outdated. * Compiler doesn't understand switch on all enum values. * List of test targets is outdated. * If the help tags file was removed "make install" fails. * Vertical movement after CTRL-A ends up in the wrong column. * Channel test is a bit flaky.- Updated to revision 1591, fixes the following problems * Crash when using function reference. * Using ":call dict.func()" where the function is a partial does not work. * Get E923 when using function(dict.func, [], dict). * Warning for unitinialized variable. * Partial is not recognized everywhere. * Nesting partials doesn't work. * Compiler warnings with 64 bit compiler. * Old style test for quickfix. * Combining dict and args with partial doesn't always work. * Warning for shadowed variable. * The quickfix title is truncated.- Updated to revision 1579, fixes the following problems * Passing cookie to a callback is clumsy. * Dict options with a dash are more difficult to use. * Missing update to proto file. * ":helptags ALL" crashes. * An empty list in function() causes an error. * Crash when assert_equal() runs into a NULL string. * Crash in assert_fails(). * Using CTRL-] in help on option in parentheses doesn't work. * Using old style tests for quickfix. * There is no way to avoid the message when editing a file. * No test for ":help". * Setting 'compatible' in test influences following tests. * Tests get stuck at the more prompt. * ":undo 0" does not work. * Write error of viminfo file is not handled properly. * Cannot pass "dict.Myfunc" around as a partial. * There is no way to invoke a function later or periodically.- Updated to revision 1558, fixes the following problems * Using "ever" for packages is confusing. * Specifying buffer number for channel not implemented yet. * MS-Windows job_start() closes wrong handle. * Compiler warning for unitinialized variable. * MS-Windows channel leaks file descriptor. * Using feedkeys() with an empty string disregards 'x' option. * Compiler warning for shadowed variable. * The feedkeys test has a one second delay. * Cannot re-use a channel for another job. * Too many feature flags for pipes, jobs and channels. * Selection with the mouse does not work in command line mode. * Too much code in eval.c. * Channel test is a bit flaky. * Missing job_info(). * job_start() with a list is not tested. * Channel log methods are not tested. * On Win32 escaping the command does not work properly. * GTK3: horizontal cursor movement in Visual selection not good. * Sticky type checking is more annoying than useful. * Getting a cterm highlight attribute that is not set results in the string "-1". * Two tests fail. * Cannot load packages early. * Cannot generate help tags in all doc directories. * ":colorscheme" does not use 'packpath'. * ":runtime" does not use 'packpath'. * Completion for :colorscheme does not use 'packpath'. * List of test targets incomplete. * "make install" changes the help tags file, causing it to differ from the repository. * Windows cannot be identified. * It is not easy to find out what windows display a buffer.- Switch back to GTK+2 because GTK+3 interface seems to be slower.- Updated to revision 1525, fixes the following problems * Statusline highlighting is sometimes wrong. * "J" fails if there are not enough lines. * Channel output to file not implemented yet. * Channel test is a bit flaky. * Channel with disconnected in/out/err is not supported. * Channel test: Waiting for a file to appear doesn't work. * Cannot write channel err to a buffer. * On a high resolution screen the toolbar icons are too small.- Updated to revision 1510, fixes the following problems * Crash when starting a job fails. * Keeping both a variable for a job and the channel it refers to is a hassle. * Channel test fails on AppVeyor.- Updated to revision 1506, fixes the following problems * No error message when :packadd does not find anything. * Garbage collection with an open channel is not tested. * Writing last-but-one line of buffer to a channel isn't implemented yet. * Crash when using ch_getjob(). * No test for reading last-but-one line. * When channel log is enabled get too many "looking for messages" log entries. * Job cannot read from a file.- Updated to revision 1498, fixes the following problems * ":loadplugin" is not optimal, some people find it confusing. * Not using key when result from hangul_string_convert() is NULL. * "inline" is not supported by old MSVC. * Compiler warning for unused function. * Visual-block shift breaks multi-byte characters. * No command line completion for ":packadd". * Wrong callback invoked for zero-id messages. * clr_history() does not work properly. * Crash when built with GUI but it's not active. * Cursor drawing problem with GTK 3. * Error for locked item when using json_decode().- Updated to revision 1485, fixes the following problems * When using hangulinput with utf-8 a CSI character is misintepreted. * Function arguments marked as unused while they are not. * Test_reltime is flaky, it depends on timing. * ":loadplugin" doesn't take care of ftdetect files. * No test for ":loadplugin". * Cannot add a pack direcory without loading a plugin. * "timeout" option not supported on ch_eval*(). * A one-time callback is not used for a raw channel. * Channel "err-io" value "out" is not supported. * Job input from buffer is not implemented.- Updated to revision 1474, fixes the following problems * Sort test doesn't test with "1" argument. * Channel test sometimes fails, especially on OS/X. * Coverity reports missing restore. * Missing out-of-memory check. And Coverity warning. * Can't build without the autocommand feature. * Compiler warnings without the float feature.- Updated to revision 1467, fixes the following problems * Error when reading fails uses wrong errno. Keeping channel open after job stops results in test failing. * The "out-io" option for jobs is not implemented yet. * When encoding JSON, turning NaN and Infinity into null without giving an error is not useful. * JSON encoding doesn't handle surrogate pair. * Can't get buffer number of a channel. * Using empty name instead of no name for channel buffer. * Memory corruption when 'encoding' is not utf-8. * Crash when using json_decode(). * Memory leak when using ch_read(). * JSON tests fail if 'encoding' is not utf-8. * Json encoding still fails when encoding is not utf-8. * Vim hangs when a channel has a callback but isn't referenced. * Test 87 fails with Python 3.5. * Opening a channel with select() is not done properly. * When a JSON channel has a callback it may never be cleared. * When the argument of sort() is zero or empty it fails.- Updated to revision 1421, fixes the following problems * When calling ch_close() the close callback is invoked, even though the docs say it isn't. * Using "u_char" intead of "char_u", which doesn't work everywhere. * Tests slowed down because of the "not a terminal" warning. * May free a channel when a callback may need to be invoked.- Disable sniff support, its unmaintained.- Updated to revision 1410, fixes the following problems * The close-cb option is not implemented yet. * Perl eval doesn't work properly on 64-bit big-endian machine. * Having 'autochdir' set during startup and using diff mode doesn't work. * GTK 3 is not supported. * Completion menu flickers. * Leaking memory in cs_print_tags_priv(). * json_encode() does not handle NaN and inf properly. * Leaking memory in cscope interface.- Updated to revision 1397, fixes the following problems * When the Job exit callback is invoked, the job may be freed too soon. * Starting a job hangs in the GUI. * Can't sort inside a sort function.- Drop vim-7.1.314-CVE-2009-0316-debian.patch, Python 2.7 has the appropriate fix.- Updated to revision 1385, fixes the following problems * Job and channel options parsing is scattered. * Channel test ch_sendexpr() times out. * Can't remove a callback with ch_setoptions(). * Channels don't have a queue for stderr. * X11 GUI callbacks don't specify the part of the channel. * Channel read implementation is incomplete. * Calling a Vim function over a channel requires turning the arguments into a string. * ch_setoptions() cannot set all options. * Can't change job settings after it started. * The job exit callback is not implemented. * Can't get the job of a channel. * It is not easy to use a set of plugins and their dependencies.- Updated to revision 1353, fixes the following problems * Compiler warnings in build with -O2. * When there is any error Vim will use a non-zero exit code. * When the test server fails to start Vim hangs. * When the port isn't opened yet when ch_open() is called it may fail instead of waiting for the specified time. * The test script lists all functions before executing them.- Updated to revision 1345, fixes the following problems * Crash when using channel that failed to open. * Crash when closing the channel in a callback. * Channel test fails on non-darwin builds. * Channel NL mode is not supported yet. * It's difficult to add more arguments to ch_sendraw() and ch_sendexpr(). * Can't compile with +job but without +channel.- Updated to revision 1328, fixes the following problems * Cursor changes column with up motion when the matchparen plugin saves and restores the cursor position. (Martin Kunev) * "\%1l^#.*" does not match on a line starting with "#". * Channel with pipes doesn't work in GUI. * Crash when unletting the variable that holds the channel in a callback function. * Can't compile with +job but without +channel.- Updated to revision 1294, fixes the following problems * copy() and deepcopy() fail with special variables. * Encoding {'key':} to JSON doesn't give an error. * assert_false(v:false) reports an error. * When jsonencode() fails it still returns something. * jsonencode() is not producing strict JSON. * Crash when evaluating the pattern of ":catch" causes an error. * The job feature isn't available on MS-Windows. * ch_open() with a timeout doesn't work correctly. * ch_sendexpr() does not use JS encoding. - Remove vim-7.3-diff_check.patch- Updated to revision 1194, fixes the following problems * New lines in the viminfo file are dropped. * Old style tests for the argument list. * Generated function prototypes still have __ARGS(). * Wrong argument to assert_exception() causes a crash. * Illegal memory access when using :copen and :cclose. * When running gvim in the foreground some icons are missing. * Recognizing does not work when the language is Turkish. * Using searchpair() with a skip expression that uses syntax highlighting sometimes doesn't work. * Cannot define keyword characters for a syntax file. * Can't sort on floating point numbers. * Default features are conservative. * Conflict for "chartab". * Using the local value of 'errorformat' causes more problems than it solves. * 'langmap' applies to the first character typed in Select mode. * Langmap test fails with normal build. * Autocommands triggered by quickfix cannot always get the current title value. * No support for JSON. * Build with normal features fails. * Coverity warns for NULL pointer and ignoring return value. * type() does not work for v:true, v:none, etc. * Automatically generated function prototypes use __ARGS. * No error for jsondecode('"'). * ":argadd" without argument is supposed to add the current buffer name to the arglist. * Missing error number in MzScheme. * Expressions "0 + v:true" and "'' . v:true" cause an error. * No tests for "is" and "isnot" with the new variables. * This doesn't give the right result: eval(string(v:true)). * No test for new behavior of v:true et al. * The +channel feature is not in :version output. * empty() doesn't work for the new special variables. * test_writefile and test_viml do not delete the tempfile. * Crash with invalid argument to glob2regpat(). * free_tv() can't handle special variables. * Error messages for security context are hard to translate. * The channel feature isn't working yet. * Can't build with FEAT_EVAL but without FEAT_MBYTE. * Compiler warning for not using return value of fwrite().- Updated to revision 1130, fixes the following problems * Repeating CTRL-A doesn't work. * No tests for :hardcopy and related options. * When making a change while need_wait_return is set there is a two second delay. * With 'rightleft' and concealing the cursor may move to the wrong position. * Vim can create a directory but not delete it. * When using ":next" with an illegal file name no error is reported. * Using {ns} in variable name does not work. (lilydjwg) * delete() does not work well with symbolic links. * delete(x, 'rf') does not delete files starting with a dot. * No longer get "." and ".." in directory list. * argidx() has a wrong value after ":%argdelete". (Yegappan Lakshmanan) * delete(x, 'rf') fails if a directory is empty. (Lcd) * Using ":argadd" when there are no arguments results in the second argument to be the current one. (Yegappan Lakshmanan) * There is no perleval(). * Can only get the directory of the current window. * Python None value can't be converted to a Vim value. * Memory leak in :vimgrep.- Updated to revision 1087, fixes the following problems * Wrong way to check for unletting internal variables. * The Tcl interface can't be loaded dynamically on Unix. * Crash when using an invalid command. * CTRL-A does not work well in right-left mode. * Using "." to repeat CTRL-A in Visual mode increments the wrong numbers. * The CTRL-A and CTRL-X commands do not update the '[ and '] marks. * Crash with an extremely long buffer name. * CTRL-A and CTRL-X work badly with blockwise visual selection- Updated to revision 1066, fixes the following problems * Segfault when unletting "count". * Illegal memory access with weird syntax command. (Dominique Pelle) * Typos in the :options window. * Compiler warning for ignoring return value of fwrite(). * When a spell file has single letter compounding creating suggestions takes an awful long time.- Updated to revision 1046, fixes the following problems * The fix in patch 7.3.192 is not tested. * When a symbolic link points to a file in the root directory, the swapfile is not correct. * Vim overwrites the value of $PYTHONHOME. * The local value of 'errorformat' is not used for ":lexpr" and ":cexpr". * The column is not restored properly when the matchparen plugin is used in Insert mode and the cursor is after the end of the line. * When there is a backslash in an option ":set -=" doesn't work. * An Ex range gets adjusted for folded lines even when the range is not using line numbers. * Using "q!" when there is a modified hidden buffer does not unload the current buffer, resulting in the need to abandon it again. * g-CTRL-G shows the word count, but there is no way to get the word count in a script.- Updated to revision 1004, fixes the following problems * searchpos() always starts searching in the first column, which is not what some people expect. (Brett Stahlman) * Leaking memory when hash_add() fails. Coverity error 99126.- Updated to revision 979, fixes the following problems * When pasting on the command line line breaks result in literal characters. This makes pasting a long file name difficult. * When using :diffsplit the cursor jumps to the first line. * Using ":sort" on a very big file sometimes causes text to be corrupted. (John Beckett) * test_cdo fails when using another language than English. * When changing the crypt key the blocks read from disk are not decrypted.- Updated to revision 972, fixes the following problems * Test 87 doesn't work in a shadow directory. * Configure doesn't work with a space in a path. * test86 and test87 are flaky in Appveyor. * Rare crash in getvcol(). (Timo Mihaljov) * The asin() function can't be used. * Memory leak when there is an error in setting an option.- Updated to revision 963, fixes the following problems * Crash when dragging with the mouse. * Segfault reading unitialized memory. * X11 and GTK have moure mouse buttons than Vim supports. * Memory leak when encountering a syntax error. * vt52 terminal codes are not correct. * There is no way to ignore case only for tag searches. * test_tagcase breaks for small builds. * Writing tests for Vim script is hard. * New style testing is incomplete. * Missing changes in source file. * Test_listchars fails with MingW. (Michael Soyka) * Can't build when the insert_expand feature is disabled. * When using 'colorcolumn' and there is a sign with a fullwidth character the highlighting is wrong. (Andrew Stewart) * v:errors is not initialized. * Sorting number strings does not work as expected. (Luc Hermitte) * 'lispwords' is tested in the old way. * When a test script navigates to another buffer the .res file is created with the wrong name. * When using Lua there may be a crash. (issue #468) * Vim doesn't recognize .pl6 and .pod6 files. * A few more file name extensions not recognized. * Test_tagcase fails when using another language than English. * Vim checks if the directory "$TMPDIR" exists. * When setting 'term' the clipboard ownership is lost. * Test107 fails in some circunstances. * Cannot run the tests with gvim. Cannot run individual new stests. * test_listlbr_utf8 sometimes fails.- Updated to revision 935, fixes the following problems * Test 94 fails on some systems. * test_utf8 has confusing dummy command. * Crash when using longest completion match.- Updated to revision 930, fixes the following problems * When a BufLeave autocommand changes folding in a way it syncs undo, undo can be corrupted. * Python interface can produce error "vim.message' object has no attribute 'isatty'". * Libraries for dynamically loading interfaces can only be defined at compile time. * Compiler complains about type punned pointer. * t_Ce and t_Cs are documented but not supported. (Hirohito Higashi) * Wrong indenting for C++ constructor. * No utf-8 support for the hangul input feature. * New compiler warning: logical-not-parentheses * When removing from 'path' and then adding, a comma may go missing. (Malcolm Rowe) * When running out of memory while copying a dict memory may be freed twice. (ZyX) * Compiler warning for comparing signed and unsigned. * A digit in an option name has problems. * The dll options are not in the options window. * The rubydll option is not in the options window. * Missing proto file update. (Randall W. Morris) * Leaking memory with ":helpt {dir-not-exists}". * Prototypes not always generated. * User may yank or put using the register being recorded in. * Completing the longest match doesn't work properly with multi-byte characters. * Ruby crashes when there is a runtime error. * A clientserver message interrupts handling keys of a mapping. * "gv" after paste selects one character less if 'selection' is "exclusive". * MS-Windows: Most users appear not to like the window border. - Refresh vim-7.3-sh_is_bash.patch- Updated to revision 898, fixes the following problems * Build failure when using dynamic python but not python3. * Indentation of array initializer is wrong. * On MS-Windows the iconv DLL may have a different name. * C indenting is wrong below a "case (foo):" * vimrun.exe is picky about the number of spaces before -s. * Custom command line completion does not work for a command containing digits. * Editing a URL, which netrw should handle, doesn't work. * Freeze and crash when there is a sleep in a remote command. (Karl Yngve Lervåg) * The 'fixendofline' option is set on with ":edit".- Updated to revision 889, fixes the following problems * Crash when changing the 'tags' option from a remote command. (Benjamin Fritz) * 'smarttab' is also effective when 'paste' is enabled. (Alexander Monakov) * May get into an invalid state when using getchar() in an expression mapping. * Vim leaks memory, when 'wildignore' filters out all matches. * Compiler warning for unused variable. (Tony Mechelynck) * Not obvious how to contribute. * ":find" sometimes fails. (Excanoe) * Coverity error for clearing only one byte of struct. * Can't see line numbers in nested function calls. * Test 49 fails. * When leaving the command line window with CTRL-C while a completion menu is displayed the menu isn't removed. * Block-mode replace works characterwise instead of blockwise after column 147. (Issue #422) * When doing an upwards search without wildcards the search fails if the initial directory doesn't exist. * Using uninitialized memory for regexp with back reference. (Dominique Pelle) * The OptionSet autocommands are not triggered from setwinvar(). * Triggering OptionSet from setwinvar() isn't tested.- Updated apparmor.vim (taken from AppArmor 2.10.0) * add support for the "ib" and "mpls" network keywords- Updated to revision 865, fixes the following problems * GTK: font glitches for combining characters * "zt" still doesn't work well with filler lines. (Gary Johnson) * Dragging the current tab with the mouse doesn't work properly. * It's a bit clumsy to execute a command on a list of matches. * Vim doesn't recognize all htmldjango files. * Filetype detection is outdated. * pango_shape_full() is not always available. * Still problems with pango_shape_full() not available. * plines_nofill() used without the diff feature.- Updated to revision 854, fixes the following problems * When '#' is in 'isident' the is# comparator doesn't work. * Compiler warning for possible loss of data. * "vi)d" may leave a character behind. * CTRL-A on hex number in Visual block mode is incorrect. * Moving the cursor in Insert mode starts new undo sequence. * does not show up. * Saving and restoring the console buffer does not work properly. * "zt" in diff mode does not always work properly. (Gary Johnson) * Missing information about runtime files.- Updated to revision 843, fixes the following problems * Xxd doesn't have a license notice. * The ruler shows "Bot" even when there are only filler lines missing. (Gary Johnson) * CTRL-A in Visual mode doesn't work properly with "alpha" in 'nrformat'. * After CTRL-V CTRL-A mode isn't updated. (Hirohito Higashi) * With a sequence of commands using buffers in diff mode E749 is given. (itchyny) * Invalid memory access when using "exe 'sc'". * Gcc sanitizer complains about using a NULL pointer to memmove(). * It is not possible to save and restore character search state. * Illegal memory access with "sy match a fold". * Invalid memory access when doing ":call g:". * Invalid memory access when doing ":fun X(". * Invalid memory access in file_pat_to_reg_pat(). * 'linebreak' breaks c% if the last Visual selection was block. (Chris Morganiser, Issue 389) * Invalid memory access in file_pat_to_reg_pat. * Cursor moves after CTRL-A on alphabetic character. * Invalid memory access for ":syn keyword x a[". * Crash when using "syn keyword x c". (Dominique Pelle) * Crash when clicking in beval balloon. (Travis Lebsock) * Resetting 'encoding' when doing ":set all&" causes problems. (Bjorn Linse) Display is not updated. * When expanding `=expr` on the command line and encountering an error, the command is executed anyway. * $HOME in `=$HOME . '/.vimrc'` is expanded too early. * More side effects of ":set all&" are missing. (Björn Linse) * gettabvar() doesn't work after Vim start. (Szymon Wrozynski) * Comparing utf-8 sequences does not handle different byte sizes correctly. * Can't compile without the crypt feature. (John Marriott) - Refresh vim-7.3-diff_check.patch- Updated to revision 803, fixes the following problems * Repeating a change in Visual mode does not work as expected. (Urtica Dioica) * Accessing memory before an allocated block. * Using freed memory when triggering CmdUndefined autocommands. * Test for ":diffoff" doesn't catch all potential problems. * Using "A" in Visual mode while 'linebreak' is set is not tested. * C indent does not support C11 raw strings. (Mark Lodato)- Updated to revision 797, fixes the following problems * Using freed memory and crash. (Dominique Pellej) * Test fails when the autochdir feature is not available. Test output contains the test script. * The buffer list can be very long. * Can only conceal text by defining syntax items. * Can't specify when not to ring the bell. * The 'fixeol' option is not copied to a new window. * Warning from 64 bit compiler. * Crash when using more lines for the command line than 'maxcombine'.- Updated to revision 788, fixes the following problems * CTRL-A and CTRL-X in Visual mode do not always work well. * :diffoff only works properly once. * Behavior of :diffoff is not tested. * Background color response with transparency is not ignored. * Search does not handle multi-byte character at the start position correctly. * 'langmap' is used in command-line mode when checking for mappings. Issue 376. * When using the CompleteDone autocommand event it's difficult to get to the completed items. * It is not possible to avoid using the first item of completion. * Equivalence class for 'd' does not work correctly. * Coverity warns for uninitialized variable. * Using CTRL-A in a line without a number moves the cursor. May cause a crash when at the start of the line. (Urtica Dioica) * Compiler complains about uninitialized variable and clobbered variables. * line2byte() returns one less when 'bin' and 'noeol' are set. * Still a few problems with CTRL-A and CTRL-X in Visual mode. * copy_chars() and copy_spaces() are inefficient. * Using both "noinsert" and "noselect" in 'completeopt' does not work properly. * On some systems automatically adding the missing EOL causes problems. Setting 'binary' has too many side effects. * It is not possible for a plugin to adjust to a changed setting. * snprintf() isn't available everywhere.- Updated to revision 763, fixes the following problems * Appending in Visual mode with 'linebreak' set does not work properly. Also when 'selection' is "exclusive". (Ingo Karkat) * Using CTRL-A in Visual mode does not work well. (Gary Johnson) * It is not easy to count the number of characters. * Cannot detect the background color of a terminal. * When 'conceallevel' is 1 and quitting the command-line window with CTRL-C the first character ':' is erased. * Spelling mistakes are not displayed after ":syn spell". * The request-background termcode implementation is incomplete. * Comment for may_req_bg_color() is wrong. (Christ van Willegen)- Updated to revision 752, fixes the following problems * When setting the crypt key and using a swap file, text may be encrypted twice or unencrypted text remains in the swap file. * The tab menu shows "Close tab" even when it doesn't work. * The cursor line is not always updated for the "O" command. * ml_get error when using "p" in a Visual selection in the last line. * Wrong argument for sizeof(). * In a string "\U" only takes 4 digits, while after CTRL-V U eight digits can be used. * ":1quit" works like ":.quit". (Bohr Shaw) * When using += with ":set" a trailing comma is not recognized. (Issue 365) * Cannot specify a vertical split when loading a buffer for a quickfix command. * "p" in Visual mode causes an unexpected line split. * No tests for Ruby and Perl. * The entries added by matchaddpos() are returned by getmatches() but can't be set with setmatches(). (Lcd) * ":[count]tag" is not always working. (cs86661) * ":cnext" may jump to the wrong column when setting 'virtualedit=all' * For some options two consecutive commas are OK. (Nikolay Pavlov) * It is not obvious how to enable the address sanitizer. * Unicode 8.0 not supported.- Make Perl support dynamic bsc#804070- Updated to revision 729, fixes the following problems * Illegal memory access when there are illegal bytes. * ":let list += list" can change a locked list. * Autocommands triggered by quickfix cannot get the current title value. * Overflow when adding MAXCOL to a pointer. * When 'list' is set Visual mode does not highlight anything in empty lines. (mgaleski) * 0x202f is not recognized as a non-breaking space character. * For indenting, finding the C++ baseclass can be slow. * ":call setreg('"', [])" reports an internal error. * Occasional crash with 'list' set.- Updated to revision 712, fixes the following problems * Out-of-bounds read, dectected by Coverity. * Not freeing memory when encountering an error. * The filename used for ":profile" must be given literally. * Various problems with locked and fixed lists and dictionaries. * E315 when trying to delete a fold. (Yutao Yuan) * Fold can't be opened after ":move". (Ein Brown) * Compiler warning for using uninitialized variable. (Yasuhiro Matsumoto) * Joining an empty list does uneccessary work. * Compiler warning for start_dir unused when building unittests. * Searching for a character matches an illegal byte and causes invalid memory access. (Dominique Pelle) * Can't build with Ruby 2.2. * Window drawn wrong when 'laststatus' is zero and there is a command-line window. (Yclept Nemo) * Undo files can have their executable bit set. * gettext() is called too often. * ":tabmove" does not work as documented. * It is not possible to make spaces visibible in list mode.- Updated to revision 694, fixes the following problems * When starting several Vim instances in diff mode, the temp files used may not be unique. (Issue 353) * When there are illegal utf-8 characters the old regexp engine may go past the end of a string. * "zr" and "zm" do not take a count. * There is no way to use a different in Replace mode for a terminal. * When "$" is in 'cpo' the popup menu isn't undrawn correctly. (Issue 166) * Memory access errors when changing indent in Ex mode. Also missing redraw when using CTRL-U. (Knil Ino) * Can't build with MzScheme. * Session file is not correct when there are multiple tab pages. * Running tests changes the .viminfo file.- Updated to revision 683, fixes the following problems * When using --remote the directory may end up being wrong. * CTRL-W in Insert mode does not work well for multi-byte characters. * MS-Windows: When Vim is minimized the window height is computed incorrectly. * The search highlighting and match highlighting replaces the cursorline highlighting, this doesn't look good. * Typo in the vimtutor command.- Updated to revision 676, fixes the following problems * When 'ruler' is set the preferred column is reset. (Issue 339) * Using freed memory when g:colors_name is changed in the colors script. (oni-link) * Using "0 CTRL-D" in Insert mode may have CursorHoldI interfere. (Gary Johnson) * When 'M' is in the 'cpo' option then selecting a text object in parenthesis does not work correctly. * When using netbeans a buffer is not found in another tab. * When 'compatible' is reset 'numberwidth' is set to 4, but the effect doesn't show until a change is made. * 'linebreak' does not work properly with multi-byte characters. * There is a chance that Vim may lock up. * 'colorcolumn' isn't drawn in a closed fold while 'cursorcolumn' is. (Carlos Pita) * Can't use a glob pattern as a regexp pattern. * When netbeans is active the sign column always shows up. * Using 'cindent' for Javascript is less than perfect. * Warning for shadowing a variable. * When completing a shell command, directories in the current directory are not listed. * The first syntax entry gets sequence number zero, which doesn't work. (Clinton McKay) * Missing changes in one file. * When a FileReadPost autocommand moves the cursor inside a line it gets moved back. - Refresh vim73-no-static-libpython.patch- Updated to revision 658, fixes the following problems * The tabline menu was using ":999tabnew" which is now invalid. * When using "gf" escaped spaces are not handled. * Stratus VOS doesn't have sync(). * When splitting the window in a BufAdd autocommand while still in the first, empty buffer the window count is wrong. * ":bufdo" may start at a deleted buffer. * Compiler complains about ignoring return value of fwrite(). (Michael Jarvis) * Configure check may fail because the dl library is not used. * Can't match "%>80v" properly for multi-byte characters. * Xxd lacks a few features. * Insert mode completion with complete() may have CTRL-L work like CTRL-P. * glob() and globpath() cannot include links to non-existing files. (Charles Campbell) * Text deleted by "dit" depends on indent of closing tag. (Jan Parthey) * Missing changes for glob() in one file. * Compiler warnings for pointer mismatch. * 'formatexpr' is evaluated too often.- Updated to revision 640, fixes the following problems * When using Insert mode completion combined with autocommands the redo command may not work. * The default conceal character is documented to be a space but it's initially a dash. (Christian Brabandt) * 7.4.592 breaks the netrw plugin, because the autocommands are skipped. * Marks are not restored after redo + undo. * If no NL or CR is found in the first block of a file then the 'fileformat' may be set to "mac". (Issue 77) * A search with end offset gets stuck at end of file. (Gary Johnson) * Incorrectly read the number of buffer for which an autocommand should be registered. * Can't build with Lua 5.3 on Windows. * Combination of linebreak and conceal doesn't work well. * After deleting characters in Insert mode such that lines are joined undo does not work properly. (issue 324)- Updated to revision 629, fixes the following problems * For complicated list and dict use the garbage collector can run out of stack space. * Syntax error. * The NFA engine does not implement the 'redrawtime' time limit. * Vim hangs when freeing a lot of objects. * Wrong ":argdo" range does not cause an error. * luaV_setref() is missing a return statement. (Ozaki Kiichi) * luaV_setref() not returning the correct value. * Compiler warning for unitinialized variable. (Tony Mechelynck) * Returning 1 in the wrong function. (Raymond Ko) * Compiler warning for unused argument. * Crash with pattern: \(\)\{80000} (Dominique Pelle) * May leak memory or crash when vim_realloc() returns NULL. * Possible NULL pointer dereference. * The last screen cell is not updated. * Compiler warning for variable might be clobbered by longjmp. * Coverity warning for Out-of-bounds read. - Remove vim-speedup-gc.patch, fixed upstream- Updated to revision 608, fixes the following problems * Compiler warnings for unitinialized variables. (John Little) * Can't match "%>80v" properly. (Axel Bender) * Range for :bdelete does not work. (Ronald Schild) * Parallel building of the documentation html files is not reliable. * Conceal does not work properly with 'linebreak'. (cs86661) * ":0argedit foo" puts the new argument in the second place instead of the first. * Using ctrl_x_mode as if it contains flags. * test_listlbr_utf8 fails when the conceal feature is not available. * When doing ":e foobar" when already editing "foobar" and 'buftype' is "nofile" the buffer is cleared. (Xavier de Gaye) * Crash when searching for "x\{0,90000}". (Dominique Pelle) * Using a block delete while 'breakindent' is set does not work properly. * The test_command_count test fails when using Japanese. * Tiny build doesn't compile. (Ike Devolder) * Cannot change the result of systemlist(). * Out-of-memory error. * Memory wasted in struct because of aligning. * It is not possible to have feedkeys() insert characters. * ":set" does not accept hex numbers as documented. * 'foldcolumn' may be set such that it fills the whole window, not leaving space for text. * Running tests changes viminfo. * The # register is not writable, it cannot be restored after jumping around. * May crash when using a small window. * Compiler warnings for unused variables.- Add vim-speedup-gc.patch to improve garbage collection performance. Based on https://github.com/neovim/neovim/pull/1761 (boo#899747)- Modify vim-7.3-filetype_changes.patch to expand tabs when editing * .changes files (bnc#900839)- Update suse.vimrc to stop remembering file positions for git commit cases. This fixes bnc#538369 and based on msys commits 1ef258e and 65ffc90.- Updated to revision 580, fixes the following problems * Ex range handling is wrong for buffer-local user commands. * Segfault with wide screen and error in 'rulerformat'. (Ingo Karkat) * No test for replacing on a tab in Virtual replace mode. * FEAT_OSFILETYPE is used even though it's never defined. * Ranges for arguments, buffers, tabs, etc. are not checked to be valid but limited to the maximum. This can cause the wrong thing to happen. * :argdo, :bufdo, :windo and :tabdo don't take a range. * Non-ascii vertical separater characters are always redrawn. * Giving an error for ":0wincmd w" is a problem for some plugins. * Having CTRL-C interrupt or not does not check the mode of the mapping. (Ingo Karkat) * Building with dynamic library does not work for Ruby 2.2.0 * Can't build with tiny features. (Ike Devolder) * Address type of :wincmd depends on the argument. * Mapping CTRL-C in Visual mode doesn't work. (Ingo Karkat) * No error for eval('$'). * Unicode character properties are outdated. * Redrawing problem with 'relativenumber' and 'linebreak'. * Matching with a virtual column has a lot of overhead on very long lines. (Issue 310) * Using getcurpos() after "$" in an empty line returns a negative number. * Wrong cursor positioning when 'linebreak' is set and lines wrap. * ":52wincmd v" still gives an invalid range error. (Charles Campbell)- Updated to revision 560, fixes the following problems * Tests fail with small features plus Python. * Crash when computing buffer count. Problem with range for user commands. Line range wrong in Visual area. * Cannot build with tiny and small features. (Taro Muraoka) * Crash when doing a range assign. * Using a range for window and buffer commands has a few problems. Cannot specify the type of range for a user command. * Since patch 7.4.232 "1,3s/\n//" joins two lines instead of three. (Eliseo Martínez) Issue 287 * Warnings for unused arguments when compiling with a combination of features. * Highlighting for multi-line matches is not correct. * Repeated use of vim_snprintf() with a number. * Using "vit" does not select a multi-byte character at the end correctly. * Function name not recognized correctly when inside a function. * curs_rows() function is always called with the second argument false. * "ygn" may yank too much. (Fritzophrenic) Issue 295. * Langmap applies to Insert mode expression mappings. * Various small issues. * Missing part of patch 7.4.519. * test_close_count may fail for some combination of features. * Failed commands in Python interface not handled correctly. * One more small issue. * When the X server restarts Vim may get stuck. * Appending a block in the middle of a tab does not work correctly when virtualedit is set. * Memory leak using :wviminfo. Issue 296.- use SUSE LINUX GmbH everywhere- Updated to revision 537, fixes the following problems * With a wrapping line the cursor may not end up in the right place. (Nazri Ramliy) * Using status line height in width computations. * Crash when using syntax highlighting. * Sun PCK locale is not recognzed. * When using "vep" a mark is moved to the next line. (Maxi Padulo, Issue 283) * Specifying wrong buffer size for GetLongPathName(). * When the X11 server is stopped and restarted, while Vim is kept in the background, copy/paste no longer works. (Issue 203) * When using ":ownsyntax" spell checking is messed up. (Issue 78) * map() leaks memory when there is an error in the expression. * matchstr() fails on long text. Daniel Hahler) * Still confusing regexp failure and NFA_TOO_EXPENSIVE. * Crash when using matchadd() (Yasuhiro Matsumoto) * No test for what 7.4.517 fixes. * Many commands take a count or range that is not using line numbers. * Comments about parsing an Ex command are wrong. * When using 'incsearch' "2/pattern/e" highlights the first match. * ":hardcopy" leaks memory in case of errors. * Warnings when compiling if_ruby.c. * Can't build with tiny features. * Test 63 fails when using a black&white terminal. * Value of v:hlsearch reflects an internal variable.- Updated to revision 516, fixes the following problems * When generating ja.sjis.po the header is not correctly adjusted. * Users are not aware their encryption is weak. * "-fwrapv" argument breaks use of cproto. * Generating proto for if_ruby.c uses type not defined elsewhere. * Crash because reference count is wrong for list returned by getreg(). * Memory access error. (Dominique Pelle) * In a help buffer the global 'foldmethod' is used. (Paul Marshall) * Completing a function name containing a # does not work. Issue 253.- Updated to revision 507, fixes the following problems * Setting the local value of 'backupcopy' empty gives an error. (Peter Mattern) * Compiler warning. * Crash when expanding a very long string. * CTRL-W } does not open preview window. (Erik Falor) * 'linebreak' does not work well together with Visual mode. * Issue 26: CTRL-C does not interrupt after it was mapped and then unmapped. * The "precedes" entry in 'listchar' will be drawn when 'showbreak is set and list is not. * Cursor movement is incorrect when there is a number column/sign/fold column and 'sbr' is displayed. * Can't compile on a system where Xutf8SetWMProperties() is not in the X11 library. Issue 265. * When using ":%diffput" and the other file is empty an extra empty line remains. * Using byte length instead of character length for 'showbreak'. * When 'balloonexpr' results in a list, the text has a trailing newline. (Lcd) * A 0x80 byte is not handled correctly in abbreviations. * Abbreviations don't work. (Toothpik) * Check for writing to a yank register is wrong. * ":sign jump" may use another window even though the file is already edited in the current window. * test_mapping fails for some people. * Cursor movement still wrong when 'lbr' is set and there is a number column. (Hirohito Higashi) * Cannot specify the buffer to use for "do" and "dp", making them useless for three-way diff. * When winrestview() has a negative "topline" value there are display errors. * In Insert mode, after inserting a newline that inserts a comment leader, CTRL-O moves to the right. (ZyX) Issue 57. * A TextChanged autocommand is triggered when saving a file. (William Gardner) * Cursor shape is wrong after a CompleteDone autocommand. * XPM isn't used correctly in the Cygwin Makefile. * With some regexp patterns the NFA engine uses many states and becomes very slow. To the user it looks like Vim freezes. * substitute() can be slow with long strings. * Test 72 still fails once in a while. * Typo in file pattern. * Language mapping also applies to mapped characters. * Cannot append a list of lines to a file.- Updated apparmor.vim (taken from AppArmor 2.9.0) * add support for 'hat' keyword * fix highlighting of comments in alias and link rules/bin/sh/bin/shgvim-basegvim-enhancedxxdh02-armsrv2 1713774167  9.1.0330-150500.20.12.19.1.0330-150500.20.12.19.1.0330-150500.20.12.19.1.0330-150500.20.12.19.1.0330-150500.20.12.19.1.0330-150500.20.12.19.1.0330-150500.20.12.19.1.0330-150500.20.12.1 vivimgvimrcegviewegvimeviewevimgexgvigviewgvimgvimdiffrgviewrgvimvivimgvim.desktopgvimREADME.Japanese-XIMgui_x11.txtgvimrc_example.vimsuse.gvimrcgvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.svg/etc/alternatives//etc//usr/bin//usr/share/applications//usr/share/doc/packages//usr/share/doc/packages/gvim//usr/share/icons/hicolor/128x128/apps//usr/share/icons/hicolor/24x24/apps//usr/share/icons/hicolor/256x256/apps//usr/share/icons/hicolor/32x32/apps//usr/share/icons/hicolor/48x48/apps//usr/share/icons/hicolor/512x512/apps//usr/share/icons/hicolor/64x64/apps//usr/share/icons/hicolor/96x96/apps//usr/share/icons/hicolor/scalable/apps/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.suse.de/SUSE:Maintenance:33536/SUSE_SLE-15-SP5_Update/abf4439c5c9e7f068a189fff5e613809-vim.SUSE_SLE-15-SP5_Updatedrpmxz5aarch64-suse-linux cannot open `/home/abuild/rpmbuild/BUILDROOT/vim-9.1.0330-150500.20.12.1.aarch64/etc/alternatives/vi' (No such file or directory)cannot open `/home/abuild/rpmbuild/BUILDROOT/vim-9.1.0330-150500.20.12.1.aarch64/etc/alternatives/vim' (No such file or directory)ASCII textELF 64-bit LSB shared object, ARM aarch64, version 1 (SYSV), dynamically linked, interpreter /lib/ld-linux-aarch64.so.1, BuildID[sha1]=33520e3dcdbc80659e413f8a2babe5c577679dfc, for GNU/Linux 3.7.0, strippeddirectoryPNG image data, 128 x 128, 8-bit/color RGBA, non-interlacedPNG image data, 24 x 24, 8-bit/color RGBA, non-interlacedPNG image data, 256 x 256, 8-bit/color RGBA, non-interlacedPNG image data, 32 x 32, 8-bit/color RGBA, non-interlacedPNG image data, 48 x 48, 8-bit/color RGBA, non-interlacedPNG image data, 512 x 512, 8-bit/color RGBA, non-interlacedPNG image data, 64 x 64, 8-bit/color RGBA, non-interlacedPNG image data, 96 x 96, 8-bit/color RGBA, non-interlacedSVG Scalable Vector Graphics image%%RR R&R$RRRR"R R(RRRRRRRRRRRRRR RRR%R'R#R R RRR R!RRPPP P PP PPPPPPPPPP P `8 ^ 驏#utf-85d3ea5d260859c8e4a00e6ab583006eff6788105a342fcf4f6a78e0b3823dc53?7zXZ !t/]"k%{J #.4G .g/qfD⑤\hRXDbJ-PA)- |qsՆ'( ˊ^BU%"J(K!s9ڏj00ë'|7M/͠KN \SQL/ԸL .q2 P+?J O\g W nQGjxt',=$ȭl7;u-R(WdAeu=IKXms=M_n á<1g]0gUaBrb>֊eSx LPD n&,s1(1v@4< ZD LtZ Ů>dӆ G*/7jMvՙ?3 =,\r$.k(!>%rs߯ mU.*7XaWg.(>+0_(?}w>hnn29%_8܉:u=8 􀔅kUa1`Ki78>p ~&UOR+7l\AOuiG;TI1 ݗM}aQy+3RWmo7fF?hC=wJFW283lgrP!fyyRJDEDdh?blf5IЙN6]}X |<HN_HYLTz 1muc ptmWe%Wt2rջ+Fl)]|-Od`ctE X&꣓_$5z_IPJK&p!2hٙS<.͗fܙγ(=Oi9iK(fv{m!vZV7zc:xNPVčjdgN)^ȣU -J6'%],u )"bD QB lX9}x;poH} $Ad?,(Fjédݧ彚yVR߳)XB *]⃝p$4Ռqؕ^).^`V 0_;@eN~w (!Z[iw_1G\^sburP9y9SMҭw?GAc ^kۙ#قPoB֐fU48|G(0[ +eXkpM(1-r7dG< ?Sp J>hs6yTg&x>4 0}L.fF#Uv쳰`d`#-B}ypXUUi{ۤqC#5tw UwfO֋ʻlH"jW +M 2"&K.;YpCSxrv;[>Ӫ*ي?acVGQ@Y–Kt69{%xlmdnJ9; dfoYUuˋRR]2 (B̵}iD,dqbpzR ix_{U,ny2̮o7s_3Qw©v0S*ܡeۚedp-7ꠛʘdo5RDe@ Hs3s/u/d anjBDY*l1ȱE gǡdC`I?՞XA[o1]^9ԠcATwPoq82Uy4ũ\CSk2mz'RyyC"TpقF5ֹ'dFȝT!͵bj97uXay`N0 ?K Qb8uK!woV2cW`C#{ 0؄/od \u @h'Oif>0SVY6o =s?F{ l$)IWz//pW+?eC=eSDn2Qw^k; ~E:_x28fw4I{ӐQ{›A&ptΙdJ)/Scpkϖ@#(~-0fpqǤsրUZɢŗ|E7{  u;?u_:t(FEPj0dp0g#R  {λx@KhGFю\\O}n˗!̝roXWx$]RXJnŬ.NסJEC%"m .K$~5D8B-Fs˄)M'LzN+?eXLs IXR.u y $YԴ &{̓{ȹs%Dt.b!Pu~_\5k+~s*GO]/Dseb`5'eYrest8+wX{ _)ž(9xV\O?F}B=Yǜ乷!ХOēԄ3Fr3Mlȁ|snO򿠸fhufC0<Ŭ?..3{Uw܍Ÿ'95Pb t3AI"Ļc4 YS}'2W8m|JQj>,{Gn<]b^B+bv];{5rF8="&ճC`8^)߀$`#r chwn@D[?s#5B(+Mϰ\Vh$AGz bE?OzڣC *񋇮Azb re;£T^gũt%Wsp "L+Y@ ?/u$Fg+..cv+~G=@ð>OfAgAq.<])3QvG :PaS43OInKw(i>{Qq [Od\T&p'ۄWH!*$r-Vi|,got;AoɟD{&aVgp ܙrI29 gr+6Γ;hsxczl$ 鿜C$PEN0#NqLh 4Wa\"ΐlP WŻ*66ȃajz3f?|^ghiTnEPjv*U#3hDPBdYoڒ"p7'5Qt`n/ٴr*}xʹI i4V ]7bQNtIY3@P'ӇHW=i% na !3n5j`QOfkc?s9BeK E Z:hL p%8\f}uSYsV~rܒVMbŸPa!1i=B} #Ι)J)qJ1axK^ f)(4[!phwDnDJ7^3Ҝ#xӫv>sF_t+~S7sHk&JG2mJ_VnO╦<.rJ}J+pC:URQQ %Iw<ϴljFv*(ӞgpgEy R-~k8D_-˺DsF]z][[%SrôB`EfֆD$TF^ ^N4\諺W2ooU|a!F|N0tO'8udD3ӰOw "#cHΚAoJ܉fi q_rx@!a~@ &p}pK޿Q ¬Ks~!/ ,w8Z!.3M^ˊc+e}ݨIVpSBK@kq񊪯!5uhs\(xd_EX]/zЦȤ~ Q`2jp_{G3k?A )Od+uYӎ$p&\: u{eJMB?yrЎxd 3 Wi~u櫨;y(PJSN@z?jRNi WS_7ZQV dp.lmjOHUİS/x` [6r1jԍ!1oմ tN_ܸ`qgO@}O0a1mLb@q }P69&LAGK;=$᦭<;d̏ѭg&ZjӼP&w6'EPѶ.5(Teh!:0yՃAgNENS[K3EIIkSD`y^ MOHW71/Y&y߱w.5˘ lULpvaٞ@rlwH8T>c=D.I,U>ʹ~|vosda[TwH76YډaYQq jY NcP9͡jf3=!W`k6XcZ51Иj@$qtAEM*}5Hԭ;*`e#UW4IiiH?c\y]۶ ]\l@!,sc!TB7ZqKᴌvW//͐`0[W1OFNi!fѱܵlf }dɲko'El@4XR)3U8J-J|"¾ lTjeie#U"gR& 1=xBZ'GfDGcr$^r(kL~YvqH9l;`bm^ύ@'JdctqR}EF-"vA9}d: );cQn8 ̚m1} Z1Vi'b sG!]1+sHeS#Lu G`u*!76vk1IM/īƚmKeE >׊onɥqQ3!E9YcNƲ=ݤZ}a@ҢVO֕I@{]zǞYU N9̕'~X EisWwf{Jrnl\ й?Ҁn;҉5Mv|.&!Y*x1 \s~_ &W)H\=;k> g_MsXE+FV ^O>t؜5Q\3c岵P=.nB/Wgg0 h?EUCd~V9'fF7#Kh--, 7 &*x6ܘCQ_w!8IFv\a3JUXEdR(MFBX8.s%Y+m)37|9Ea_rЍ\,<"xm.LP)֭ێDm V7« o/zi|1QՒhڻZפȉlReim ꓥ;&# eZvL04Rwk(Ez;|=* U05:Ж&v22!R܅ ;0EI)r*v4ק.4͐jNs-s4 Ȝ65W6 XnEz"8o*E؝X}6k<|ۍ&0UeӰxžB!w&@݌C4D5+{aBNQo@K"POo78D["4:̍IZh$Q bOMԐ C=؈Fa*KVaꝰh.進=DuVTRr+5î p(ڳ m7lTR'[,1͏Z&9HqUTU26LX ԬЕg "q nهz?Ba??H:Xۇnv\ވ5F/Z=陻xʬ!T3WWBD t;Y^ Gfg{ɀF2E<qa-pL>ےE="+9'oy:aR?iӌkA|~vîj(8=HϚd=XFM_:^!>qMT(uh#hJS|2E7dS9.hf[j:8G6HskIk2ko^_B4 FHD%-v\>I=aSϽIN&H#v|]Y:kAeH' |,<\`إ?Y8*ŤYCNg3fzC̈́> zTD5x8憩pMIq욐FecUO5{"$sACsKa;8,MHL5J KːtGcG/>xpcH7;wP ,Q*w sd5V9Xm^'eX${HLVB}7M6ċp ;ҸzfΖ2fy0 [9;xJe0ꌸ+ IQ)F ŜÛk]1Fڲ p2i=omS1HuNlڳC=U0of| .Mb1tDEX#1ئ'b@]T+4h~t{tl.hGFpSzj{uAK}  PeQ)|AX#OK,?8"fTY@mf;p"Hf{T_:<'3:@@06n68)$سe;WB`jG+!DmH/;HH9Ύ͚dz(RZ1i8Z[B`q/pun3-kdxBx]SƯ1S& f'vɵȟ@RHzVHY lEw䀰kEX8:Nino"^3]JZ;m*\5tS5~)~r-^x6&nf1<=̓j,迨a7 96T (ҙ?)I+*+{3N.bY)ONcf|M-.K˜(g7Ե \MOPft k 6RyA;ۺSz5Ȋ!cQz|}` EzCh>z޶H4/ꝧﺩev/@B*.⁃'J@"m-LN{e:g9+ŕM=WI)?o_U@#7`J+w[Q*"u\c-Sc N̶J#`MNl?7ԧƚ%L0z$c17.)i2o7rDgomIzGw{K9tBtB'FW!|nޯr̷Csq~\娯Eߜγڧӯ5%T6eH~)h_;*G6TTY_vٌC!nmWt#󶾤FO>Hp=S)mK',W,WT&ِTKK2!.r',#;Gdh:;w ~U*e&|g K5] s!K. LdWu?.ڲB@9HKcCѻy8f)/t&c";Zt5+=+Rj{%eP.AU>f*\ 4<RV"ks,Cd9Jcw^FH) A6dSlSb׸rpO 9ެջ&|7FE:= U4|2JQϾޮk -  # `FˇOQS+MbرqNWsi "?k-y2kն~兖1z#{u: c=|M֣៙X}hi?cd@f8ƐOȔB ?A Rkf*=E @a85?k4 #I -''R BҠ Fvw6}EqKQwh^9 j+rqn,ߌ~ZB(wBN %'N7EL`7>ǽ-e#`hTm#8I&vtY(cV)q-_6H{ZvHS)t.Gv;SP`oпN,F?# w ZWidwpB'>\/|dp( !'Nb>~}/?}RK'r5xDINA\Jd}iDPdx=nP J0@~v?Fi<.aX˰@BxW8DIˬQJxa.X^#һ c8%d,/# iE' xR)I9j_  5Ԝ>McQ2+KTTהpq- "閦4lUk?o$JDmbnKVQ.M2"*FRS)Tz..zdj`[8 ,0% ~,RҝAs/AeB> Zxטؗ2+~m;;h,;ʲ$w DE/\D?/FFi ۏӋ@0Z'#uPrXFl8.W:}o4k)ɨf WnYf Z@8.<@uLAkOU%fRBgMF&GJ>HNmc /؞Jy/jҖQE@Tt*0=]y?r^LqYv27E9WZum@G<`Ģ2 L 3A@b]7z݈z8BdUr=uUk<GNYP{9([jKW50Wxt|4vFpG٨Bn񮉆S7IY>!rqsJ([#Gkz)Un-^Q'1q\A 3A#юDiѶ :˟RH zdnԳy#taF׉oSi >AЎ):cv\啉3O$8)·E(.,RmVlǕe$-0&.N Rh¦RvGY5bp98h=8+Fzו[kIS[D=&OQ n!yz^[iU8RQ,(yCiuSzuNx2Psd(MuXC'BE4Ҏ4$IJOWER8"aCX 󮏒!HU u[@e0˖ZF HVY{:^At:c{o(u逇wXoRׂe =گ۶.H#kx@抟B:R\&(aͤnٵޒ!5ԋ.[0uZ(3'ڿ[yNK7/-Mq~wzji u׭Ӄdy]Xn4S?100 Ẃgt85D]zL[_c(g|]xpk+dԭ'u,p`- H #c(y.5SipLse ilf ˥gz`PLƞ]<1Go'Lj9~#\E0ƪXkDv7{_nO 9ip}T(O\ݝPR]e P>hX~*!3:q@V vQh~.d>X{^!f{1bd sZ&Pdt鱓 R35)_hF nzoq5CuYܓJv1}J)WdYk"H鱋g/fd;B֐v"|½Nbnv+ 7O®Ƌ݉8" K+ʛoa w!YLqܻ$>oKq@X^0Ӯ(cFLj0ѪMi ⡇;#H{[7 Wx:$Z,v Cxلv,8ydfn({_dF|EKݒ T:~~H;*^Xe`p2NSOt\m2м03y*{PṎPyA0/f$×T]KH3HOifn ੲ函Ϩ]{k}[+݁pe^T) $V|QI H&qd Xv}-H3Ż8][L4R/ZĜU|_R@+R윸sL җΘ\̺E[Jtx=+6u$ݫU|{!Ls&fj_y@)̲sJբշpuI!Ed&ud񣟴 Yp5R^XKӣbqw8\#E!x엢dPpش) f,H!gbFIy"0a{6fX*{\fPQ(>L"i5Ff<%!T`ԖT6O,gNioxj:oD9Jq.Mʌ|O?j@ "Ϟph ${JܽWŽIFBXqoN0):m9kuޛs Ptww}pWDg2hrWvS84q@BtćlJJoOzɯP jڤISn=;p}c J`.bI"'Qq~!lP0^>v?3cy-'IMTg쉅q`Eh8CFz&;~_)1EigV{=>$.&Q*A лgXw2f`q6](Ȃ'V ;BHX6FCR#v5\qzPH RdVf&UсOX1YW^$U&$I-WTD =J^唀R&:riڲncà:M9w<P:e<֍%eu_~ЋE;]͊bXrTU2V,N i;؉qsQY[qYff|W~ةcYq$<}PO1du|јp}p Z<F+UwYQW|"H:ez>A6p`]ZTǿe'5MYğpL̙{)L"͉~hJ᪓tˢai9Z79dhHODdE{]rmΖ^{++4.8ھWr=lX4՞xœt{5\v#D>c:grv>ɬޗ] (GOxHr%/!/=%]Utа+ NCL_p}K}7XaB ˝x{{fQДY;&K#,Ńе#Ju^7.L R6~/i;j~# L†0|Dԛ {Tpy4DҴΗ $);( a\uW<ָR eAm.ߏ"qҲʍJX3 IoPcg=S!qBڞ|{l"ݛ7Cbd$kŴQ:r@ LXDR8,($ 8)%a.~U;uAnNA;O@ȇo y?cB 8Nw p R&hJu!(Lo݇C=K訦[*F\NKlJ <,L+30usLxF7H9XMCjȔk3F3/ܛ9nhif98y[EhP;S.}"(2w=Ep^+5cvELuh9 "lk5N $Gfo)>,9<2%$>gHuS*iFs]~kq]+U[dsqm%%u ixN+SFq0\+@)kSJBwU@-t\6 ZWQB.U)I4#6}SvXOSª_(0 h4V*KBɊz‘|:BAY(<^ eSԋȭ5 +jPu eK}FsjdRyL408bsl k2970`{Ctqy굛 \*NM~00B z݄]0ЃY ø2ArLK@]{6%Y]{~7(ě+\CI}g S^q';:b?5Qb8Wc3&jG4 EhXH9:*[bqrV1T d**-/f~Ob+.[8uSlS-ovuO)aXoWye趩 )h}[ؽ McÉk+_ʹq7=nsE^0=A^zI {=bƈZ_ęx3=<6Nr2D,BeRQ) ?pa0U1r;hQ{#I:G|͉tX2cz^V(ߩn ^3$6om/ e{f6׌c甀7mFyoW+"ܕfWuVbۄ oL P_9K-`M3إ+~bC`9RگoQ/5cBQ;>Br`=ZbjUxo+zOAhؼ> }XZt&uha!5֎)8R&8#T~-L,yj#t{֌FoFIcl5"Є>򿳘+-Gz\E^NU;:W@W7FEZ %L;,)a-9ez'<[* G"۰*:韾ȼ@yldHTW08ro O=rN+4`F8Q$>/^\u?ǏL '7V#BX8CmzȓQ#6hn{~Z= ET%sXft>uxXʔlrC) E%yx%ne=$"ֆeUfz\Kyٷ6`W4\.S.Z[H;LԿ4EfGt<ݻb-mi57XT5!s6[s R|rsyF@ udH,i23l 7Q](<${Ly {_bSr9L _0GT7,aQ8@-xctdT$H.L 9s6#νtoGl PgLj<3^ 1^.ۡ\KޡfA Z =GI(+M4胵Pa;4جP:ڃ7@!U-]QĤ[@Rx9=J8jg;yD@%^^eX5$_. m?HZH U:ȵw/B5e~Oռ tmMQ(5p:ҤЪxe|6AN~~yM}T~56ͮ]!3-ڪN4"o|T';-1F ۳ ;cl:Ēll:yz*1( G_[6&>H5h 66?!9)w5U}օ./<[kAZ1*m +OI&BxM!-  1-Du ~oG*=GViaPIq(cTZ5U& bBwllo^3O%[K}kW36&r2ځCsz2׬{iH AK=E__ֹj^D(,p̬xyMZ J飚t+J\a%+/y P} iCpBΞ6R<2I/ds܊f.cmܦ9P2 ‡d(A4ŠIxo I7>$%jNg^>Jct_ a;DpY|'Cϯ1]řk~8z}GX4BtA4CAclrtImɡLqjZ_;AAz7. %~ܠ+Oh*[[.o\)w+(7~eNSD࣌ſR03MD[_{_vh(o]n[MkbLiaTȯ&#hq}I&/pm 0q5>۳fO}B\B7a%Ӵi~؇Tº3eRe0ݥX\q,s Z<ȪQ1',}3Mf-I*̎JrfgL&ÑsW;m001M1Ydc( 2V i3d!$/0X#,Q,M-j xJaFZ1@~Ι`"ԇ.Ė>M;w@_z`ںxv>H4a(egx,7%Q'hEjWz aJ[a g=@DC|crɊRt;[`S['VgPOU{X 'NX`ee`m'{x=ɣ*AJ[YٓFwSz8韁 R%;B؉wǬ̀]H\N xNјMLYhr?ZǑ 9 ܔI@9"Y 7;?WEr|pD)Iq[12I3l>ן0n*?]4OK.9=e҈`/XQp ƅdB koB_h0Vx+%.{;};"7t!^Q<T^qM|AO,Z2+ggދ|;$Ā3{tQHesoBVolgǑ-ҟ8*# Ne&ĸs\o387h$Ќ%Kׅޠq73f72fF5J(gz\c3+ݒĮ7-(nӐ7₇tI4j4!i[|1rc^8+D}XFH> sn| wE4S?h n͹8exU9/86M`k[\ɾv,JsogIc=ok&z~kg<,9\ѧ^2;֪ϴԅT%Z^nכlPŚ}Ԅ6w(6C!<86q{خ"Ͳq6  OܩsɝL?a LW8C 0B]u8X@(ML[U+vFzz*P~g̋kQR$%؎^ѷjd@Ji 2p5 amX3R?-GEݳsKc*Hr<U|j3,aPp۰<[&(5 ӠFU-$P|hzt+UBB㕍k{Ag>ǤOAvJr| *.)ʪ.X`eYFOR4$P)p _9=ScNAhv1;&\x~[}߯mfC28k_B3;2-l 7bl^u- 8J)=@UUm۠i4Kg?!3җPAG d3Ĺ +M-ff3l-ɘ/>mV<}=:Х*՝Bn;[P=ڝ70S;"탩yzh { WtU"1OR1>ݔ4Hj~e~5+OlLx{J}:/_DLCQiH9%Fs^gݓ7l1*/"݁lXg .DZ9ROTs{0ut.;UBeR'ܱݼ8OA sNu[_ sh/8;u-&76T" !:pQ!Q_Ȫ6sE+ȮhH EQboẸ L#5 oӅGT@D;Eܞ [/HG#jR-zԒEW*G$1.cT&V=]Hj؋SI~gl>y\ʷz~s?nWe<3QvG@,z( \3f pN;z-Y 8VmǘH; oxrr\@:;& yޑ'˖iK OH >'_%pα 5&[fzR^76?Y 2 /LxP>άzpl@8 u _OP$3=Bv}IMZbmzՎs d52̼`bZ"DE6^$ktgp |:BnYυYdӑ繵8v4?\5_qGLq Ss9 :A.; ӻp_Yag wv˭p=U\X"-JUAF tk0IGy qk5/$^XK}8IgD?ù6rv3̦.!/í_}qaXZ<%mj86RU#)-N¬gHLGvt5 3k9u"R]Bt]Ĕ ))c+ܭ!|2"ԭ'_5]q/ yK ЏgBq|2HGVQߴ`K3C|3:zcQV2҃`фH* u_ 'UmTsmY8KV)_o#Ơ QKDa0B=jW1h Np ZF ! ㉍q? 6i2&" sf8[|X`;rL˼Zĕ͝-4:5/w27jV„?*V 9[>6\}<6C=6ct'oo5HBw䜔{ XF8Y՟y+33I]*@}cS #|,!m!Qӓ襔([(e S'Qč'q{^NP(!!B AETR*˹Gd4I~i}`OZ\ 捍³ KfQ`TVZ$yO'u]JگC:\ABCa3|+UFO}8'B,@d}1D_mtޙ9vcN;ϟv SdYcФ`I62&r):딯Q;jXn~g嚯5Pta$-̻J8IO#(7JnzSjW|BWbZNh{n,vbjvY_7uʼnTmP%Vmb|ߎ4w=sH; _~jz& 3ߤ/Ը6{/ז"t;+wF FtkNOW S;yӇ/ dA+]P~%4Y=Opl#6pl>fuN9g줘pC}t/Fe1!:%/, [Զ#DP.>J׈JLD/R㗽gA~xļJCU7{t',l<*#%W|D=#͊X%`nOxl ]ŏ. To(`o;)l?L!&i+.['@ v:wi4+]I6 @j!cۤ(i+fJ(BaQӗhgENՇFV(𬐿-lr&):ސV e86P ZsؔZCGBm1[BʗdxۭQP3 t#ۤCn,>Էcj%ܖvCR?.Gm<%QYs.. Yig\nAZ@ݗpi2b3՝ 'omI0٦IAe"^E:;ɖiv~-++IOzTUC <s+Kv#]{]Ҳz / ͕ȕ|UD7\$'rp~+Q,5>ɷ:VZq̫SwCW1ª?LjjcȷQ<"GD"<1(wƭRXtL4^9/̈P!&kig/"^AkW♴l֒'>,걏q ,$K&AKTJixn6{i*7;T Wp4.8lqed{aKξ.v퟇Qu75ts|{{23u qEuM#Φ}l(s AM7CE26mB.c(O`@-cinU~S< ؊nu!*kXc +HAxkH >=W#!C PAh=X8X rя:+, @jken`sgM7Îѷqݑh J]۠("4e0_T%]FcT /t6PzqG\&FԒid2:aDvTAtX,&۩~\e<aZ>veio6᫔ r YZJ:&N٣3=?J#8<%p$T&{extAmx>;?RP)pwk2' zZ-8FݳM \ ŏy/bB:^$@``-uMrPrTs9vW -JGnwiߛ( Fh:zR\~t -93 F|}SK&bG_gP=z$o]M#VU%"~]S:W=;dCVH4:)@=2~>^ߘf@mKcqmxq8sۛa ͢M0G#H0/0xfrOrBc*xf Cp3F_d%O٭*sKV[{|.Zk#)EBJi^1 < r}$ƿj IP1 hf2Pd<$`J9SgT1dAS08$i&3=vqC͕uXi=5Lh oWɧwr_1r-X;}%6ΤF,ڴGid$ou"r-KVجAZ%ERfM9@ndHt/J$oVP>a+{iF-ʎ_E10U 5^ꖾZ= |&xgfC{ R,= gq3-m)[[WmCZ^F*QDӸUR3pNTLTCD_GQ/wNI臘=)N*y3G ڊGP" r|o }{Zt@OCe5|r]/e*b&EI{!Z;;2ڷˎ *c#:=-a!k4X{gzexshrr"snҔ00!Dh Y >?L 6ZИ80jJc)7W.Z@1cEx44S5!*Ik<+ZI`0oWhngx'mlbJ6mTa@$/u.%5:ƿUfvĎz1F& +22H2%+O(y\{/ĺ|j$tЭҞWږۅ.ehQbM֛}Vpxro*u/|ң&}\>@Mx/QqTMzb#\W<ٜ@ڛҬKcW{{e$q2\="PeA @!*CIl# ,}wSBڇkc\t׈%ߝx 'dϬB1צ#~6~\X@用)T!G \D Flol+6UNJCH,0E{uG.@*N#Qr(qXXYѱiNT?ӽ弻#Pl>d/"ڛq}VvGZk8y+h*)$²qAA}hȚq 18[י(cVg Oxw2"~mWGx4}(Y'Bs1 Qg1%۩q;mon\Bd̬4 7UPrAwk:0t I9: R.?9vastciԮ)FQ9Y6Tvݤsʔ, d*Ԣ^iCnWB Ŗ8ܐ;c+fm<56P8^O 2\ [PG\\3T - Vh$zK݁J/cqyj~ bs k+$YZ{Yb _ti59߲O aG'b*M$j+-LU9S--}od^66zIΚKY[/+~h,S@[G>见CsrO2 aySzwJHg$(NgK#ĸ|K5ыleH(mTz֡ԌInPe,* YޟNc2Xu &Tkh$W>FG0.el֕q0Oeg@IB Μ!>yM;MI<; D›Q/H/nwpJ,v!;dJpRTBtܷ;yY1Z(IM Nc ݞ r"y\p/ā_dX,OVjݧ1%q0 lCʎ0[<Zd:*Eͺ";DZDYJJ)6G X=-"}I)H[ c͊jŰ"J?SVS E LRL׎םh;[c9i*'H_ַURxz>js֗ S.raռ^r@ BDIC\Kp,W boq?uP= 8Qc&*"RFZm‹yTGX6%W޴pҢBHJOVA]:Rkۀ XB0WV{ib3ǻ(x<Į ;ΐ0ب_>ev1!8iAxWMb֬9PţBFa5DIrhEv؉o0t$̿)Sdfe 3LX+`죇$mW_ɬp_ {4r+= a؊vQE^/ˏlݸzCs:F.-Wqp$ߠ?%Iu`W#P퐌/qcM}IQ` SVhzNf>v5/ib75毆mw }ڏBq/,lc̅lWc|R5e$,7eȕeҮSQ/>gɽ2ަOÅra^`vh( ȜA&ʪAznÊM搏~]-2qq2w Z/MXpɌ_-kQ _ٽ=u[, Px9C@cx&dc\ !c8Q *Bl,Ұ)qc{$C%K5 xZ9F_~h0](#~r3^F:kSX_FuI"_}+v@R-Ɍ9Hq!K<5oFbطNue-Hs?g_}`jP\uCA /9ESiNQtRO[=|'R+z  RK|gS9Y*5W^TbhllEF= [đ+8TgF旙yI՗W} n aӈ)Gb$ :JLe2zYZ".tF"jiPf.J  D.9m}g$N~!5pO>X!J-w9PC65qEbSs(nl{ύJ.48ַT5 A9@A*f[ݰՆAeCVd}Oq>KKqѺU)ۚřFZ Zi)[>H-܉*fHpvrx^Ii (oAȠ4l;3p4ׅPNmR4*̇:0Bw0"lO@0NIcQ60M,6q:ԅkCZTݽ4VSkM+z2`wfwNٵ\1Um4=-ݸdR[9M;O@݋cQ%^3VΜpP#y)yw_(, >GЄIǦ\W秩}1@~ܜ ] <~>/:ٸU-ճ0nXrOڴ/ `z6^t5w6>ae㚊pyNj =2sD'% j:«feP(!8!$<$&b.& eJ0jЅFl$wUFZ& FjV:yg!M^aqS۶_L:=Y 0+0BR o2*Tc OYTVfE4b\rLWWܯmh75:(DԾz@>hu /u? 9cQSTt#RZD qA۵*!3kOM(:zJpΤ5Z%)P~Q_+ A{ZU ?F-/A4\i_֏EcLB40WWyHEA>KB;׬P*r*aiR ,A25'<?ғᚣ0UiasmoA׳ KS%<Пz4^Nm:;hBfU8|z0 D+_'^(p¶7:/,P=t*aC,CEElM;\qhzycNIMMw'Dr(%,ֲڢ2$Pl W2$[oyx*}` 0}huPzn,%35%?*hT]ҷɰF /C5ZS)\bHQO[Q&*xH q`ӽ ޽kjʕAuEW;@6 JQƈO 0eHZ)-|NHVо%U=P'MT? *t֏(ܠ'0nP%n7;,"2X?\=t5Ht[q0sIJ^\,_'HUQf?kShOɚ1_":lt=5Ӝ6mEDF^Oġ:~ qJt iȖFs|7s14swP BCrLT~vWH=9 l7"G. cyV"u$>Js ?" LE #A^nԍ9 Ͳ` P nV\u?h IG&x]G3ȶ;P-_vǦ|4^?6V\)W7/9G vKhoOґȨSj:@JKT %Q}NU\X EVU @xΨ_osn2g٦ELW0R& 6PU\~}PJU+~ĺk- ?0`<Vi0-C> T9+k! z3\DA$B7YHEKTBqO;RPL\Bɧ)tO]!&G3sPA1=wld/f,,ƧFl+9 1YL%S^ k۱?.΄+ H5 hzOubl4އ%YE&oГ|%Ŕ[+l[QMN⌵ ]o;TR2?H/,Z%y\/bf^D{D\e}eZA 쀂ڣ55A xtf?P6>*>^cF +viW_p04uXo@+%g:;R*uZ]y8IwQ JlOF5V/hg0axߜvb̙Ct|?xi\T@R%3~t0DݰxF ]Vwi_M:  _]tQL;^sXuBS~*z^=p!&%=jÿ`l2\c]kQ@){BO`lH:3Q?SYPe䧋8\]p1Vew mZz1y R†+Id̲V-0mr.I%J,;A#Q5󶞄`x~3#zR|Kri2ZU|娯}ƧjSg@O5~020[%?&m"Ya9 :.lz!ZWMz0I汃nZVOoH،' Ҝ `3M̩~1R=W!J;:%9Vm&4[ba6Umard@wNUk)?|)K 9c\2,\Va'+WB22 -а־ !`$w(LXjs~c ѰXB#[eR)>OT*q=aG3c%d<Ϭ;Ԁ25PyC.&iv >}Dz^na83t'MXBTWt25N'4HЀ8EBFUgw %6jQ-0UN,-6wl@-Q9x!U ޵;L1BV[<%xӖgv8XlX诃5O([yƬӃT&J 8\G:$W.Oi; UWEԨN9[;E OMޭB'r6d,\a_142VN+Wr\^9?5)rꅙt%"-UpwA~b)Tp01\^&,Y'AT}6ga.WQr"COY'(Ky8ӅZnvLq a # iXy!irwʱkɏ`H2f|5s%kI@woЁd%ʙAE8׎z 4RSyy}^)47P{SPgD4x"Lˈ 0I"j_Ov|o̫ͨT7tE5⏯"-gn<Ծcϭ[l{(biMD97oAa>vlo` ] u֊jJ Ti?ՉvFʮWMAo+\$)-tmdzMz`.wi|)◁r7%BhE,:Vɖga-63 i)ܽ!Ө|\~aĮvr{Tiq)gd2"HU@H%#G u|) vi)9a9& gS$pY| y5t9Fb<Z<i)Hfѡ;i,M7Pn ULw n9Zh:[eCF}n8\)U @si ar]Si ww;} /lF@&`gQ;CCރh@V.qL#-cvIӓ_e<*-ց@DtoGWhl G$*yxA|+sO?36s[nHTGOx1WueV zT9h@;a4ze!ڰTڽ oB6De^ ~6 ΐ(ya2yP@0V2lPXm[@gXcr9w{8>-EqL}58K4A Oڬmqcov(wXpbpT_=yE8?ZKYT|F')/ʂ.GT맰p_=;T5E_5L ީFK奢7Y{v@&m9~p ^@gG^UW]4`%./[[-;sNͦy# M0wK2*{Вi+ν#ϪmUpƲ"Fn1)rIa~q*Ww K1ܨsꠢVt,Uj=tz2"C P\)Q9? /sͩ股@yBR=# I0 ZKb}G璩6%. gbfuad/YrQlx5Elx@m&_TQ`<)A&9~ mC"c 7B*4ZZYK:eWy5l1p5uVV!DbxK.0#a O:kU"|@wTkg(7";qa ~ݢK,n\%& 汃 tM$$y(Rk9ѿ5DTJyOtȑx$vMVCQZC:/ַKa_vQ?5HT߷NGqH ')rQ(Et-4=&3Yyb ҽhhg6@Kv5?> ^ZzE<5XYm!sÀ6 Sʘtz)/fk jݰ@R?5pSt3ي7GM=Cz/ * qn?03 |ѡa =_('r<*ކ5OE)>Frhm%8r43jZ 'ӊQ#L Q%!2Jɭ_|$rIr .ErKmhΓy !;؟BF)唴IKj? xf.FD#㷇[B[Od:vJ.lv,kѨ/3-l\)RX-WL1#* ĥP] $KT^64}wmWe%5VnюktYv뉣7W">,h3{V Mbx.Jq֔%RÌ` |-5y&ДztbO/%=2h[vz,cvӎwƜrܛ.D7oh+oL{yc%</t4ap0Dt"=4'q 7gVe9ܳ؟}eLvD3*-7m>۱\[ n6Qbߘp9tbb[:G3_0B6TͦFґ o8!/8 *j8ħԐPS]Mˠ׫uTh8|ڒֱ턐*.1ԁQ"`Gx<#OPϸ9/HPv\;{@a$pϫSC7K2PfU_Et0/td0V&|WDP$jPJё^gm7'A -[m#_75X>t͆Vѣ^uG x\Ev"dYg1ߔrzcXEQ*T;$H,EC#aC}A,r,^Vwb([H#J+q}o=RNYJ2VTH1$lLW-0G;8>>Fadd#1| .,۫/y=בG.P꧰RCQʣf2pWT< B\׺1o#@t 7bZl3Ml!Y"(vl: ̹-}G,/"s9DyGP.|vl7Pq%iceUY䴸-VQU]棶Z`A\I>~^J"7Rb@_Zmͥ `,VNiWŏꄈ 54>zMb'gwseZtno#qHh=N-SfXϓF<)ûm8m);!{k},VHy &dZP⤒gUȍeSb2^Tc՟D`ؒЅM8_i-< C`\*ݮS7?Ƃc~Ń YS_JV})7=$6GN;;6@L78r&~ik;(rSh+@xa~Vyopa=vzI_M=˼[2 `` bv6j47|GPrNC?m'ak~Tf|lNP9JD4?GC-$zW$Ajsκ+{\%`هvMZhƆTa_Z!K_Xo9=ؚCXQ|V4àG46b[ i wnllw'h V$Loy]#9q ~J`~ ,TGsB(|y,@c+vVht'URG>P[T.ZŲXit!N=]!)ufRAOF]tR }ndD7MN9Bnf --TX|w g2^ϊ1k [F"j{l2`YN%(19e$V1bO8#SAG، K5-B7aNU[ bѓ`UfBUR%'iYLV= U)щEPDyG7Nb.UIw5c^'ųjZslW?R|D;/]ҶrdG `9oP/0ƺ'} D eJ͕\ M1TS3 '.Nm`?e?_Yɦk֕aeyzF~7i VcFa{ĺ+==/PD N؉r^6 u0=kE lP b[{.Z)}M T1gώZb. 3;uݞ]hT)"xܩwQ*ZЅ}H"GWZ>a"wS/!r=f>geflGzvZGBsɤq? 4[x).ˆk!h9\4Vq2Tss*)LӒ\앿ܢ =\}[$xgSn=h\AErۅFj=DZA!.ڪ adBYŋY-. n˪Sgt+MAh,j",8-wo[6RG 98 awO4Vm#|A+sSG3) n ʨ\j3$I-@> -}רHpVpA𕴓`1T'*%.kU*-|'ns0 S81ѯ'owTͭK}7 Z!)1 /)ir<$rPKmA(4(,NZ5NAUT-S \]ReC]kN](_ /1Ff\ȆsAV;O+:UCIā R/ze_FEQ$7Yԛ f `D*jWeoAa^e05~aVA.JJ^BOEHP(EW$ ˜cNNyWn#{@9fH%`r,<.DIG)H;ea,IO]?0atQz&dtr0<0ʐK>kgI|ܵ}B{P2t56TRA#>1xjhM'}NťG*{{!|z`_tt5Bԍ1at5Wa^ؠ'[JT;;OcrC[).ɞ:ic $<ݾO|:$ dA6^/>5| Fvvw!!6Ymdf Uϱ#eO#}toŶ: &b( 1(Fyݴm[&KyβeXG;H55dqgX'Ng~1 ;nK=dDG"jFom5:u-.أTF g=NEN,\Ʊv6@:5vX-߱X0{-09{z.P'DYfXv6u7r!#iUwx*0C2">+p 2Kq#Ey; ȻuI•<B ?2žͪ'*&XS!FUH#cYbv#vkLen Z{*tm@$H;tBsQvQb۝'))RԵĴVp ~aX!lIߏ^%h x\<~В'( ·nij u}لiO?^;*$v{SmޢOvF%r>0 6p*ZZORѠcIF~n0ExT0l3׆qDՖ Hm XD2.޾'BVg eAɑ˅ Jg{X卡Dj"p\S{\"a7c Fneח``\XX/_NGV @W#&9.KYeu j'v BbΣ9wKKIPR+Z `ǿc^Tɡb縘q'0KJM)C}Yf6oFXcQ^^au[AgAʇE)\!xxZ[;j͞r+QàwN@ 2v]3e ;l E!rZ[/.doFRZ{a:c B /a&utF^۩ץ ׭7_J\nk:?edx{XmD@S#-yp2`Eb0k NK+3`SmCI*-sK;3jSdglf77YLgVC\F[jHxQ{c xYNqt>Z+|r<ȈSZjFy= ֝'2pϚG2?b6l)_,] dBו>ڊG+$6Lbjnv׊K %6T*M sV`߭OtkHykc!iڭ[<[͒bpߌK|"?ύTzƒoF)uʅ@)az) [0e; 36zA4$7UkF.\g%{NsΪ&-'PѨB~TFQ.U9m>Nu 5VMAxZz xJTw<(\K|쉞`]qnb^N Exɲzh/Kp5g"GNe HuLYiHvN0IdU+b'oW>IBM#tXX?}!YݰC*9U}idk*x'`Ѯy' Ә'Ο֐01i8rN )F uu}T'I(4֫0BZ%4di#1(jsVJ56xz,:uĜ$Y +H V~^K.jkSᖲu=n bpvIjU/HRo7 K/ݔX!嗽{w`!܂K7*FRM@DY45g 6v{m]h?{́ g ,TV5ړ`Ǯ@yGSbzAGd\UjĞco,?@J-5@:Ʉog8-qG%6+Y~,`w:qH`VJ:sđ=T!l~kWCqGR"yuX:`P KYz$fdۭI!Y1D7~#H'Ǜy#qɠ:!Z~T2h׬(PȨ'u&[¢Pr}f Ff6톘8<9ʽ P.G\UY" ʎFto2oIK7z=(:\ ZHS_w&Dj'2,&MgpS VfK6*(bx+c+6yzL5:@a+o +Bۥ"jhLfA+ ~H,2ω}8ep%'[}Q o=4C <|coͣ K,l_QYL)C=-lvYS+$QiXCL!iִvdz|⸋xwx9䥮`OF^&,f;dYL끂ԑvgFD<+͓kn&#:޿jc5~j!wTgN曏Z[W5S0WKU5)ɼJD=?>%x#ckkO0Qx~ŋ'\鯬n+k<:?K0ږZP>,Ǎ@^{ ʯY_&^%?u]rJPiֆ)++ |r, һWTTE姠?H?*N Dd;3KߺN5:QK 9o&?7jʌzj}nM^n*1DOP_Nɵ&]!=kyLIa.hu kxFLLl8Aegq/˽m]g}]O+mRm.u qHmz]d> \05u8*VX"pۉ貿0dunv>ؼvŌ$rmNYz‡M# )l=~5֙O~"߄a]dAHkl<< a2lj?-^Heš5Kmy+iOmPY66.z.n1މ ډD~UP q9sw2!ub 1? hspQU˒-?JB[K7+'W.^wM"۳]YSMqSD[>ג?~Ϲ؉.~@ d' G$^$ޫg^%if |­W&fm|/I1ITS+LV }r{̽X?DT6PݜRŅf; 5Z<ji6*zzq!~r1Y%o3D_U6TұOC{ sgM- ZID1g|fzASe/a%;:x/#@rSǣ٥b]3_I,w3$-g6F%'z,nZδ9͆Vݻ8ۇ%?[|fQЧ 2iuXd4F !]78 a)Bێ6ɲ:•tBj8I~ u1;%xT:(MUQRCV!1$v/\De7* QepU̚azohk5evBs8[/S!juWpwJ dsB_W"kT#eA'1*#8ֿ(ebU!ꖌ[+ъ[WA!ҫ&|Ǎ*+v@Gͪ>=; y ./A6,Lݛ Qz A^A(_Qؠ_hR^v-bF%3*,oH#HKZ6IY%dNTˢ8V*m_d4G7BxMzn/[Ydi/Kʑ1>Xm#v  1UQ-c/Fz[Z;K60~ iH'L oQ}X1F bW.`I(hw$p0daHL`j77wSb[{L/XH&C°p,͓q9 |n?jM3"]59*+[})T}%妨L&.P7Hh/!Ss4q T,J>㽟w>մ;;3e#gm«fq6_T> 3jLd67d@R-k`juZ VonYd4-zI8\w_Qx+ЧA'Ya΋!E7[) =?Kp*4)Ic KlZD#,!E=bm3'+V[.lmb'6t*Ӷu $f lӔxS8E⦕cذ ihν/3@ʹ4w;ܽ 'JV8 2`=)mN~cVO٫Fv8}#Pv@Ug~:AjR-C|aBq=f̄x&?>Hֳ|ۮX|yOG&y"7Gjt6xzcWU1!i?'1{ I֨ Yի8}g$\Nf} >(o|EEo-fzX aiɓu@XWv^oYH>i<'a27HP4D I eE4gXa)a/n}[--H ymd/ ;! fBR~!"p.QǎhU! o~} cSO{wL/RHIhwa95xLXɾOY1UBQ)\O86ņqInv83ҭh:3v`eGS{"/ XFYt\xdsɓ{ g($OGP\HzVHCI8.\4JdS Q1QQGro]"NRLuv[mH*=XW `Bizno=+:_$dtQZmN񏗦dh,I{36CY]ia'8mf-V4CY>tC"UZ_iJ C)]s*?u ԛoTOnmw[L% `XC&2)0#}5[kbGI F'2F -4uin.{_h;O]ido.֝vH- Oe*j5?8̲M㚍.~XhWQ1 V jz@Bi{aIɞl#G-Vn*0E͌=gBX~:y4iQA<;PNUVXACכ7HI^Ĉ͛A͚ l暻iq4M7e>*eal~SZ)O`ORb[KYpb@]hPUzbRr(yrpQƈ5yc~YkP +N:.UG ޾IJ1ptLDY23One>}T;2Soaz|XZ$VQ7s ם4=fʈ$ d8Nڧ G\+':qߞo{ltҤ Ց0R o5W Ӂ26Ƣ=aC>4-yc1 6Et %3z^<5?CQ<.:.zE[ގ $9eG`?:wKdωs&bԟ,OigCjX۫J8R.qN  ϚYn?%zw|T(!VI9I(h6ټ}-$Iݍ|-τ;H봝) p=Ī0b_=7j dqG#t ͚%^CuCӆOFEbpJtT5P7h#9TnNݚ)mY&E-;Ƣԧ"=^WO! Hh`ltܜ84PrP) !gEGo#!fi7>uQڪSۭX~ͪQpv~~#ᄿ6i4XTOVU:ߗ!Yx%ʐMu+S(jfXP#@Aw}2< j I k 81Y }ˍ|]eb `ĖNL)uB hQ f~ @6>~+"dN;COJ9R*<|#"' HAli]T@ WNJ*Ow%OUvkF~X_W}> Ӯo픣{ǻxٰwnh:Խ!Ya^<yo#.r׫ nQm]B#q$'r_٣ ývU>wl-_%\s1v)y| EF n'MTy@p>8G*C4iF4|3Y20Wϊ`)F?]hla^c<ن}i\*ɨQT4ܮ>__X:9,_D4jf[ΘZ%*̓otaM ),C/:ͩߠ%,EJ$rͦ귢20U*b}Ȣ^{Θ 6Qې(k(L\Hl yufqRX w{*h j^XAGx,@Z\{x'g8Deqt4G3%Hc/ڍMH H[AݣyU[\ZFBZ<BzR7B >N89 2:t2y0_ 5S[D9BIr>};*wƄfY sL:ήv}NzH׿)ʍ0A1,G(wtp@ΐ>†s"s(zs,o"CԪ +|DH۞}o)ʄ-:^TT$@ݹ&IF +DsJ]2fִ:NcoU0ϡS4[DkUn;y-~x-Тp}R\pv^.c;I ǽý8KM tj~z]-rgo 2*/Ia V|wn1]Wx$`yT!8^bK[YAQF\Eq{r V:K)Xޚ6=0[\aYM?vb@'iwǻۗ\ژ8ma4#Ǹ5p觓 *q$#tsCYDؖT^E}B׽rX&`.n}x=fE)c-0K*Q4%K"e'嚎!nS(`-)<۝jaRx($k:~WzFY'3fB@G7H:\CY>$9P‹#~de}TMY r~ joW4i`^.n{@kv>)b0p ty鞺0_l|%K W>`ݷ#wQ ^s"-':uT@p\5XȃU*+t_Qqܧkisﲈ\N3 T?~U)N3 TSuXoh )kSmNdi[LXB{KK i,ؠ(kF,-+D>F9$ ].aֵn  0(F1yܟX?:pC3y`.,u6M=ߘxRReWۜ}PFfL\oün]4}>!.ز|[?}Th_3Ϧ8t`fe^ SqF'sLߟoDI]8|<7$PO).u\%cnد+JcP Ik!v',ۜu4i3JHeKL(Vc_f:`ګtg`?QB{A<ϋ@ur 爢߈C@}%BLo-W:AUi/R'X:X sZFXb;*=Y3>d9[^t^Ȥ kTkFi:n׹*<|T5SKfpWվLSUΖ-¢o&մKXi?aAބN1Q&(@n0w"0 h;%vUfxwА9Y`t<ҵ+Ql` _̝? A ]P҉O0[У,W DwR6+|VD@(ȁq8;+N;(Qb'WGFfމK~u^ mYqFc*.eW1(]T"{ͼc!յE);5;-T`70:W$oϧa;O73"pArleIҶ;vu_=KO-l`w8B'MzU݇-a)B Y R_>i](cں˛f̗vBzڀoOAi/776 / D4qd% /鸨)6) 8 (-ND^M7'UG/BYeϊUοV٥HXu:1#bFɏTϺEe0TI9F`%o\.;K><3{\m/ѵ*f/+3J^3.rChE)=ᢱȢ_ 耒p=ũ{l2{% ^;i!`!N[ c5>8P#ja7Mw:"27MdFӈ8r{+ӨS쭣h(<P;v[1$IaVųscɂ1b8+?3gT,TqwUU2ci/'xfsa*l㦈=ɘfE>-*d~ ͙1-IWS;J"5"m1$h7H},qRR;#BPݖYϑYV8,=v4+Eqb% o|PR0DCxC C@g;P\'pꇢ[i-u72STOyUӆ`Hw1k(p38-<5^'Fk P !Vy݉Uy#Sˬq3pIt!' -DPOUYdVJ1%yVzg. ¶%/}"ܺ1q6hCzΣW=d\a% !'VH1xX!2EiXtEk@pcrsn>%czrXv;C bB ɠ.1ĚL1:o/s9GJjpwι#7BqAB!a 9U?p)}p 1yjYRG b36YWϢLqmb,!TħhiB34LQFrAi^yaqGѕӊnLx2;ʜ-UȞVAIjq&rsNkaܡpضq;anҊ,p B_oeA fS(VfnP9_wteegV='˶C]h3&Z0 Dhߪk2(ڼ G6w 9)I2wBkIK ,H`bnFvC!;pڌCO7ݩ9U/x<- T H2Vf (C(FPgXx7!Gd8\H YJ$PJ#$yw mXG^={bZ'7+[ҳqQ*^ m +{ڳ\ک*ww㰨 Cqqe{CC:9> ӯV4cz(D s;0h^1sL}Vi,x Q87K^:L:5=Co>a>FchZ7jf3׆9CiZ}Pwlͻe.v9{v(ҤW&qF1M8mr g6xʡ7c9_t|-#Tpg:J>x7_n1sB1&̹(}U!LBˇfHܞ[{ QOwryT%cYdam>^$~lV[} G݄y^Ё Vdz%^2|'jCQ#tk6/;2/f0/®؆QcL\ 8(KF(:@=qbÔC1y"|$"B8zؘDe/# ,6E*Y3b@>yqj55kFuǓn\]N{;#S{ثWGu]׌kqŵ[Leޞ']a!z_m4]J,7n9npEn풼yog#*nR΀Dl2߂JF'IڔurFcqL(B+1;E3>2 '..Onl`G.O.VJ¡ni:Q-lڕLY:Ac_%R6dyX͵ܾI$Zi /9RwQ[m Ի/X-$b+Hm@hhx'cv&<ֆeI1J)bG4Ff˜_78#'ɦw(Tf[:~<6qo:TIO5( 4wQbI`WX)Q(G} o`;(h[5 ^yOGCӻ>_Zi6#B7 #f7ȹ5b#8.ga{}B%n`Q$[Mn5Թ g@bRD#ps b&ޤ@Jl1, vE㒌gI0."܄xTLo6OP)H#T'uC}f]`y|v~]`WQ?,LEC[ٔ T|m2ϧp8EBD[c|OYh~W5mpQǚA4fP(CC vZdm~XFXWIA[.YN ;֎$ev[36m o]Z]w"]֓jn($]: d2@a@.~C&Q-D\1ιDf4?tG a(WLdY\L 49zpN767ԅҸU+PV>q͗-#N|&އs1)9Cݒdr's#"F.(s6zn:{t^%1#nRHp*urovuS><bRLg"U2`UeN&$SVɺ 6LV;:=V Tf1X H7r0`nSΪR噠҅1L-TѦ@g$GtLQ$)AĔkYu HJ6F/@ pOATDV޲T(hnvx[c7q\c8.-)" #_ۨwU٬$/X) @q@N$kXaX^7R%zz)mzLW";X ,۰ VVړ?MXkd a()5󿆐rp6˚02#*&k̚r4DMqWmÀOZbÑӐ<@2 w V m>IZ=D/I=SDYWtXBR\@\J<DC${DG}ٷȼcg-p P6N"Lj4M$nܮ.757i:fVF*񊪥)*.^<ںtJz^58uw%DB3zS0vb&)B^Ȩ%l9 @(7tS( 3%c:Kv* ɥVξ'Y#hCSuXE4,܎Ǚv{[LrWz];Z\qST ՅaC0P6&$jlXϿV|8]h$j"Plv'v},M Iœկ2IoCbl6;b i5R1>a431G"nZkjgBF1UxnGPzkG&8,`[0 ̸*-ǓQDb Ts)@te|], Ic8 =rA+BC2FW[.meAr  X _TѳX1<3 E"9%fFs>/ Jq@ |T> Pz7oeZkt:J76͊VDϊ-lRE%61 [FΧoj~=:o뚡MY1k#(ˊ]?Pf7m^̻ ^%럲0V*Lǃ pg^JfZNX'uxr ]3O&f j`׮"'6@R Fś_<&d42; ,4'ݿF7. eS Z@5xNA{+4xZS3tޘ($H 9eZӯrM&Z|:iۻݽq)q&3S6/G~2&ƍLiauӮphXr[F0HCB L9jnz\? VbІgGGs" F[tk>:꾼z<86l#l58m&@n3|U$C\H!!!&퐐jIjsh lP$I1b(]twxkDc|29!#}m͊(!Ai]Y]F)kն랡Yqgk4-kE;YJ8^M)q~5n;~߻l}{_G{> ;? uĶ~]g{< G}߿K_ק~oӷ{{~IzI?d100Z$0a@I a 4H?gIzL;i`2Xk%BBuЪ$)1QL/f=GE5Nr!H! 1D6 @?+$EHgIr$˜8FmKda,mz YK5Eրi02!9$/Bh &I$!p10BH'QRg~]< , +yHB``ْZ B\$M$C~l$|n҅"t#pL aQ;!(,h=QvOf4 M) 0fNgސLPS D%yi`g6`l;ZB:fI7L٠@x`C-BlR HEB=dp:j^f/߇{kChg! Lʠ9C 506 HHN#WQ2I$1; H /LLCŸo2ƅBߧ%c0A`wK?_1e9z&[TMTVU@x*ա6 wV@Md NwR4N]Hh}HI8X^IIo9[t(]'ф`H$az  2ء 4$̆Ρ6郜na$6L @  @AHoBruI?'aMF;fI$96[."I bAHs$ ]u<ӆIItydIL4 I j um%C=_G?n*CuRR &m+\7T UVj k"E<r]tO}q-m/7LHC=l!|O `iOԄ'@B)&r@N nMs7ʩ6MPPLhO( W4.`rHh3RꤻT?M,=upL&hrm7u$ïeʁ09@I asEoYqx;{4ب]Bp7"k ˆFDt37 p9'kbD@?jFn؁A OG! Mty.S RzJCQZa,[yTpgc=uwuh}?],VEl#?[x+aѵcvkWM XpX-8 3/}A%lƽ .@' ?ruWb¤Bq9k>[8[m[sv2ܿ{@ vMa(Oki ,o%ahuRXm 5pܤչ;͉pF ZN1"Dy?V\BRNw6&3BV"@!UTWgTUC9%1AH[J(r+ULoAbV~v"[%rv9;aVa VOśgV`1+!sapaU F/D?zaH\<  XL{R"A 4a.'( Fa P'~G}OlHvXCJR6Ex L<]uNF@g Ēw23ۗuJ$F5\;~b?AHX3_o Po<$?၂&Mpx&bҩoMV,$SJj Vs9o#ܿ),t}r|Oq.> vﺚN5/^LCZ7uB y7j gp\E8iL0 'sq;1$dy{s^7-9.nLc^{:}YAqX8 35%$ qlbq<] r:̂dFQC1"W0X#g F[ D 1ErH"EsJ_a/a|P:tG;AGb;/XqvصZDDL* $^(J lw$CLB5P -YcB R♏R6)Q g4+ND㣈lN7jn~NxddQm\@կu;g}IR 20yF.-p05" 0|e9uĻ߱j,Rܵt*ܰXeؚ'm#K"&i揗I G}9g O9S6ɧxz3aaSaމ 6KX|m2rsާ=[/WbÜIGtviD}MP>i@mxd)T[2hYzຉ{CImb,Gr15ߺݺ aۨV|6ٔO-76Wߎ#I5d8̝!B+7(0KZRa[co<(a(3M= zSCԕ h jBb@TC$0IT-.(BŗѭJ*LZ p0I2vY ʀIJm/O8 K"xDK׺/[MuZB]~0tuN{f.Q%;SnS]݋NJ9sY=nq}=T<)lM{Y~kNh,>|Ԃr;?ۻeʚ#8_I3}1C49?\IsAδrTiz?kh%ⲧKa?w\xq>״TVyǚCV[JѫP4?i-9(+oTAi={Ͽ~έ(+\> 3U>:G~)G-s:AuQd{vM-FS3G[A.i+6OKGmHƤr=x%%ٹD@{ <#WLIԄ>ED笵\_tя[We;x>^CQ- b4sگ@=wOC&k#}_lMuY=E/&W=ޫ1;/$ϫ͝o[ 5q{M0!R@k^ $39TOЀ@$$-i$&p~ I$FC! ް}@c$5!rΡ $Hi9+@$hITsعl]amv7l.0_ڪ**$ΊA4Ai6mmm$mmmmmmmmmmmmmmmmdI$%$ZNZhZjUUUUT7ջm̀S`#$L۲Y 2@$BH(Hbfs3j.MB ݒCⰛ@3I ) n{iʰݠIvH86nG9*'tK2@Y$'4RHoY  0 z@ I!0H!'ݰ5::/[4!ťɬffƍ'|z)>ef͕qNӇaydox{LP@B/Ӵ1&2lsM{ d !a+`MdP5P`I  }e<}mX$,2B^Xk*InI 5$MFIv'3RʣI cg9rg1a$N,P2Ir.LJ!&NI&Z' 0o 9oklsN>QZnZ9fJwm<-1T+`HrAH(e`"d8HMBI %M 'L8Y0,@4RNy8))fT*k)K™[O {c|c gcϮOHsЃȵ-^!=Y5ÅPyО%ǫ(r,iqՌ5fAa&9*IǫvWn;k{{rx}l",8J%`!6 idUolTfaIJol qhK&nxd j&`Me֙s6u$>3b£ Vl|W˨INy%'B0@ߤ },Ӎdw?|Y{A3#BqC '?sXI A&4:a::*UBECI4y@6og6d8d9 JG@ZsvL!MCHgZST t/ 1n+ &p 9K-HC"IRߦ|%Wʶ:JHIZfٳMK2L(nYд&Ө;q&&LU ˼S g ChChɸ` 'BQS:>q6US=56 ) d I864P $#$ C~hn9^6ZhTF BL2n7CQ$9m=6$R U%Ugk>.G\o}]Yu6}6χ'͚Kr5) `f %Tą %q34RN92&I9 ʸVZ9d&ŀ*7)"ò@$0ȄX&BIɫuCOXpi HgSd7Y$-&p\γewG=FO mڨ-0z}w$wFx ![>&c6\MKZXWnt@REN帊blr 5H p 㐓.$4 >֤58CMT(MPx[\ْHoU!b0N+k m^ pn۪7 fQnu5t5o!óM6vҸ)kp=W;t2d WGM4S@񺶛Kpդ @6 mlr 1I( QR6erf,U1a)V02`̘! . ݺGsLj \8Qt% J` >e :[\Ⴍ2*dv\*1"e@alwr U9Mly͕QE ڲRR@5uF3G'X%R7'DkR mb4ں xDTpĶG#q G \7:gaZlGO&YH/ov$k'v5ج (".q"m6l Z.ldbUE4\ƕO\ ⼉vGlz(Lc=4N| 9F]qL4m>P}_-L+@tHo}v Y)I^Pk@ĈxB 0@pl"aJVz51laI$+2``p\]u(v+T&ێq]d8drه [cTqyŰǟffq IP!gşĺ7;`xEt;";O=ܸ=^{ 7"hq<}2БI846}[-j {P' Ro5hЪN-phlu]+wWlx::.Ftd98${#17^g7͒aKNCEh">f3+jܳ&@a· wTTgT3pxbnMaevۺ6*roqrx A"ڝK3x'K ]'fq&35{ȵvJ'Y$ɏ' kwz`!3 * @!P4nw$Є!=f2BԢnwwcMTda9=M͠8FLhTS[ũ=lvpF$[.*f%* #D"$uMhkH`I!ynn8 q*o+I_Ykc$ UZ 0cьb)E!Thز s)"#;]KȎ1=DhuP\~.x,<6\<`Co00ʥYe1x.F]Zyt-;}m+@5@]8Ves r)gW - 6g5Xbж7Zec-ȃ|KG*w9Nw+@Ca<6E($!R B5gǹ븡pQ)"٨ tT)+/lFChIKPHYCS:U5@!U5 5-vYkIMM+N1qlpSNX2$ 'ɸ75w? 7 qx.ӞvX !P3dLq&%kd+ʸ%y=,)@ 7bOO59yk sc1>v" %[Kh;#x@drAKq>e,Ss ?K56_tvP]l֙6uSzKWSP1 9 $e4r ysmY@ z*]&R3P0Z6d_IyҀfo 2 ats(Eάv{+r\kJo& IjW1n! &6PD@Du},M!n~nrT wz H@z+fщa # Mik>;F9fBp.>&7Q&ٰ`0`xV3l0u bag(E ^N{3џ%"b=YFF.zW b+{87@XERj l{VB+lr%2@B>]~6ߌM]BCUVԸhPpiZ۽ ,D%$p2WM#hPVX(3qN"rENd͘-υ;ñ(# 3aho̲{} C.V(l7ck9!p{h,o\knS1DEPQ4]q5n¾>XH+# G) -JD6QC$A :rRasx2a@> 0c9 #9A g8%X9=@L89r|נ7E( r~ M{7@oiO7?dڿyaǨB!cAVq.׫\|2xCX@r`H@Ue4oU ÉHj*ь$Ơe p!5pdat;gx02-†aM:$ij ZH ʁt$bHY^B @7t)DX !&f UW"+8rf ͗j^EƠ5DU0g×: (Pq( Jv,vgGanNh]%b7=]-{Hlyx[[̜K7Zd1`Bv!d.@DcFoԀ!Ky\沦?ҩ!\"J*wͯR'Ec!-6@,pz">է'@!LBsiJCB#6=S6^4ȼ#ѕ[BA*-EvЦu+oRݡ8~V<!g̞}Z=y-<Ēv GsN oNa"ْP)х!ɴ> d$td&bmqMj)W -Rt9~ IxOmnPrKMl@"/ sZBg]qB#uUsO4G\y\95xPшA HؙI& `uPqDƚVT` b`" Q4+ ',Ե$^nM_ ;qLXPN[Z` { Ǹ/fJø`tpaBHA 7D-7no\H @-`rc,Y k86"&9= /vÔGmv.goŏG'`%jCt <;9?Mw@3e #AQ P8@&C$#V9,++-lKs䫇HuN*Ҋ"$Y8B}@$sa ll!CkwN}Uωᬠ pWH-c-PL&=Ӕ@@Y&F #oWIbcv&"+rc6&g3e; @VJCō.(F@G"cQq%7ǽ9ÑlЁh)hReea YcE;Jb} pf)/Ih˥ QB9{Z^ [ _ႀ"!B^ 9e28VJ.I'!!&-2DLHm5Ypk l6E A  Ga;RծSfOґOv6w\y rQt#)%p Wlli uD$=X  D,b]DV[:Law*L)h˵p BۜUiKgqWFTP!FI MPch4]np[bG(̶n:Z#R;RDn !ɡss.,AZDhRR G'gT7*sޭw&=L"T.D˷`.sq{yCxzV~PL(x9LC+F1m5E DD"r;Ϛ+fRrJǤoIe z,i&3˳͏4l\ٶS@3H#VT$TJ"c3̜ݢ[qMUHSRlQ 4#@d_&@Qz+|;L5M PfJ尪➚<*HB ӑxgLh|Yjt!? 8+Ь`!\ =aLu4@=8(kA.#(]$%]qۘ&R@Si*3]lM5I& V|ĤF"5N3 fޣRDo `W`Q&ۄ &äSmmժ5mkW! 2+lav@#8Ờ2֏s (B:F#h#1HRFɭC#Qiq\JKpy\ ϻuXj$b: (A\{kax.3ix5SΕ)wV œIQϪO?WUyiRZk"K4B 17&BQp,굲5k9VJ0;s8ElY4^ HHP~!.o4/ƄM=k̲TRq~/Cq83F쭓ׂT[yAƒA:~65MBjui%&pq:w'6* ns~Ǐ;@;<=]nlB phU$<=)A6Ե/tiDj88oF%bm˃SYdb߫;Ycګǎ&bqp4ki>ӌ劖Lڌm3QTB:÷{#g\G)}Vx(A1uebWRzhB:z)]}E 0!aZ̗' iʔH :w3tTlr//n8poV.tZ66W5L:y2sq*eG̣n,EJ}XI^FJ[-'f@Ba!r0|kLՐ@dʐ֚lWלЈMmvJ7 AM֍q\5qm` @I9c(@let} EAm v{xv#ϼU 5 D59Bd-\ƒE yQI6FƧPh ktq;0ot݇T4mLjɉ(.^^JKMdd`ld.bħ`E3 LnQTF! b"@!kj$1ZY5h5۳DJ3+W I$,<、@)8Bq sBV 1jPG00-,B7;O&>>?|&CG 7$1$#1=#ZQaj"@P@b:e$>wКP8*J ?B q>JT&}&<":|v";@#?.DAr@wc_{2;ؗVLn.A 0H" D z+N=ra:o.y@A<ܝj߫v) !28I3HY$Y 4[jūZ9e]ΠɒF4mi9\cC"m$D$y v Tc=q\tˤHڤj$!w*rp܅ly [D`*lh+XFN)98!dXSaeIm8^?]M=\f3'^+F[JL5͜]}XsIN%*ʾ1xɠ01C{j2.46nP!~~лqN$(k8$ٙ ~6JcPݫBGRI[+poV5w8}+mڶ<T+b_PA>ڎkj)ڛ=zn2 B'˻j˟EL`S7PţP)Z퇷9KEHj{mIbgeI9b’˜alN_w#qy$[%Lr:qx[D~?%9  *7^Wzyէxߍ\Q98'Go]J.Je׆VYO5l_.4]N[M͟KЦ*n&f-/ ~Ubw:sUmG.w~.ϳ8aۦJ5 ߰#e~Gc@Wx{pn^v{T\ګvY&Tg:lM4r_qd[}vS=p~~u&7W,oC{ɀ+5(^j.YsѦL3?3 a^VqOV}8q>+㹹`i#D| e$K.n]t-W 'v9| J's7Y4wyZo#òԑCW[.9)+J $";"w*BGry]IEYM BbNtDqx9T]wWW1W+O+ jgD2w甊D{f SZ%Z^[BE-Yeft< $>;A|nYEi!䓟9HO)),-/]*Ujmn/o @IB%+.MQ߰CtU5Ow \RtYz/^% a ;v0 d3I Um PU3v'| eĐ I! i=j=PesulJ'!/`ZͣuѤ`L,39*a@I'd E3Y.EI%!$ `[$EeJB@4 #Q s^ִ\Ha%.j,$ Sj6t:uZ&ikB_NBnI`ޒJQC=&vO>0U91R0JC$U9ۓ@sڻ3wyO%/T&\Iʵ:V`mDBXE I!% $(I H#@ $ ^sM!ϵX<[/bP&B@K0)XAp8τ1XW 1[p/{xҘ9yS:XUs+;^gkRŭ,V3"ie9!'!˫8*yflXtϕZd2J2&7qJ|ea9*BtĄ m[Nީ^zigZ k)`}j򁂮&& IdXV2\UP0Ĩ@GIUKO:fʞ+'t ) U2!$BK0,}) ,kPn7[mf-HoN$S0bH@`KC[$#flX0(4HeKA,UQ&$\SsHIt\c^^ 2zC{z!ٶ(QQAEnb(C DD y@SVa؜-;;"cIG 5?*pa#󥢇 LjYI1=S2ݜ#5&6lmR'Xٷ7"" M!$XH@X$2Ġsq`HH¨mjeIkP7Zm9jsU2+%iD1MD"iATò YQ#8=P4zqsfxztI=9ǞP􇎊2D%4(D $ 0(&׺o7<8QuH(I"0r0pe. OCP#Q#Y)D6f3%Ir1kM) &-UIzz9O3&@<},ArdSJa!PI$!$HLcQp 66Ple\9L(l (" C (evAP\ S S.@]Gq N6]E\av&vvL%E ЮQI"7쟮((DPXs ݪK.n)0EUVAHx|*(gagƝ†0eLN4cv vUGg$c)N;9Lr"dQEAȻ9TT DBv *Ô44 ;NY#mҶ2Q6EYaa+XX (ɈD9ѕa`f,Iˢ$d0j`IM`ى$g"Zڢ*Rbp1A1@!FD"& b G61 "]:[EÕb"(@A{_A"53?B$ x[`leCQp).K+B'ekR?6|-zې="-JEHѵYD2jE1UcetڡA3S-&4}1') C 2+Ỷ.fS0!˘ImKLJdCI H*$"( $kv_|f\lDܲg!S0clukEE M,BfX02H Lnsl|-ryJzg~3q|\<|íV8q;ޟ<}U`*HuBhK"I5(P5]볗EBă*PSBT;B F9,+)f%2dDQ6$)FL]Vfكv5s@rI Big70 (AI'HVPř0) |$%LwpBc6Se ™b9P070.sa-#`o` q L4&O IieXI(MA$d& ekP FB@EAHɏY2 Xa4ȀȋZ 7"RHR@QGN!$) +Jmg:H>>=Fbڔ efR#7-+HݦZ.4 4]5sy!iĄQu4iZňD"" Lcn:;`gaUCc(]\K˛v%$@M30HβXTEV. M5T! 3ai)i,, "1*EEbBL3N"YjL1b6d&e Cl`Ja؉Ji6rbCe$Md&&˩WbCR`juEȗ `G?k#xTB.紨pv@$2U1cW xTAI"R2)HLi9nUs Q T&N{N,S+N8˰S;b@8$'`]sq; NC'fiyb,bSiH+8R-Vwvi&-f,&*]lM'(ˠD*¨bȒdvHo~:˅C0@[WXt$۞*Rr%pfeɆQyu mPǭ_o=ϲ}kJt8*&iSB'!0a f3QMHDH@S/)H$I5%XUنV:d)0c3aXU\s_d]*l-ACBSN,DVĒ 6 6m3AD)4`b:ET*VbSCMZr8Ql px-P3Cv;;/IrB({-X疅lDȔztr|ʎ Y, ̙ťPS3TxXcQn\ZySJDI0a$X QFeKژ&iTDT YTo#Q82e=vl [pVa;rz=gʟ>?Bs3Ҫ!4h643mqW%Z`)XkQ}dHf9 ԰b9(hؗV+f`{.An-e"EQ`Af/)T }cTk0e 64S)&%FdHEÒ(̨)4*iBUY,d+D""`j;x(k Qh5FEldE6bM~v{ޅǧwov(PA IF5x<6ITP Jum}'ŤWBdGl 0EA& s&P@H^rT ŪYKe^9'Fa!F-Im#z )6P"Z$ST*,# ڬP j@j6 H,0N(`$;+ƬX6!\PUB##5V\.$R!iQfHE BF]NEʭV$%}`0*6dʼnĔ!6ΰSI(hUDnɷdniYp!HmSlܓ7(LCh΍FMvZg0@ET_ʐ1>EDEe!@ߦLQem2`GYX(99#\%jhDS/jA.͊!) a@aFn-b{ IdBaH%51QeQ hB }KeXMÒbbȲIT rUI572Fm(7HnEa(mtLl*2*#T4rJ*I{G^39U"C@&5vw$iD,q:g nKX5"5Փ10`!5[8a-5R&֦;.M!pw=j 8"IdhS`b*grT,tgc{lĀ(D.Xny{7PหZR4WK⃚)R 6SHL0C4PC~Ʋ +kDe5bƱ2ɈB"(""*.\( *Tvʻe2dpp#Er˜\ aE(Ar#D\9Š9s".Tƒ( 8dAp#"2Cpe.0DUArUgG+\e˰SeA1E8Sg+)&Q*2&TAE ®\ .QC#P ce6E\eTpLTH,TAbŀ," caScцC0`ɑ0&AjTY;Z)i*!ISɛ9aJ ٚBI3gc eP,&" ӻ{3/o4Awxqy=L ,B$H3" &A܊;i\ yi]&61Y5PQHLDQfrP:V6 4(:p—Z(J܊ m4$*jBYFTS -X8P"͐YgBe5, $Tj)VHmM[Eɤ&P8AIFez0΅4SpɄ@3`, ڦmJ,A# BeLKBtB%J S(ڀSVRE"OyxF{x]WZrnTC𜯞Z{xz9 yANK=w/A/urqs:.|`mIi3b JֵZ@0MJ):4P-Pe*(*@).&L"n!# 0CmH`)@R(tjRY$ U4 On|޽S&O?%|>UIY%"ZC&meU٢5Z) LDzh$*xJ ȇ82K݈d)6`DEsޙq(8C2ՍMjL P 2Jhs 9rĄC d.RT8-LeR/N Ř66"1&Ԑl"!``lV,av CfBFk*eٙ}^]|&͍*#Yd&HЃe޵ XbR$P/VLb2P[cEePY(x[\6-Ie!)t0M!P Z2bj&LF r\ʍ5j.M nEkZ6ֺB*2ԑTF @ca2$eu7t1JF琔UAlJрUP|~nT @R%ҀpvrA I0D+b(ɀ$(&eFB-X0(1QޜҮB6͙ %Eɰ*RRLM52 ^6&CX,q R$f6C0·Yq"6tiBdaLNLKTEuڅJ,% bjT1f-Kj)hgօ 9&{K]VBcm JO)DSUdAF0SpÑr&p &˜QQ.*s.˶Dq .®ETPr.DDEWar@AvTvˇ9AC(g(ʪ"*;#L.A*((l)QPU2 ]C .*ˆHTG)**A@PU().reLS"]D@vLEŠap#0*&#]EL)q]Q Gp#mp@Pp("rdGL#TQ edLL(.r¨ʠ 8a¸c.*]TPETQr팈"PaR3mu[9\`@(6Ғ2`V.2 t!+'T\`I(# QfD=cۼwe|rDP(HLԇ "b\d²L"/i!bI0Y(+haI107hBkUcweM{{{a'$44S R2S&j[E  hR( ayD I()szjɁ5,\f-cRߏaLIɽBްF  E,ëfF4P Eઘ/kD Rfl Je6;F1R{{Is뗹R31c` 1k&% Ms d̀1 3H"F(P"wedKXs3skFB RJ% `ŧv x̎JЊ$ʞ֝Uv/kHBLɂ&L(!s dfLMְ" $UX` po9sDo Ӂ60A@U$ #A9&Bg-UDa a˙Jk$66lno]/6תl<Em{Flh-mSVlwo%Bx1@@oaL-JgT0&q,XH8$A0yA<`]Qv3eNQT^]z^"^2B429f)b5J A0$$ r&䡜u:k 8S/ H"Ťa$6)&B26А zBH[SvӌnvAv$8${HI[H,\ڃ4tO qs^dOrD  P{Z\ҳCZ!$PUk! a!!3 X,6S$ CB+ۚ/IC^)T4kY6hh-Lֈ$I;ѱ@N AJZ& tQ>@(Ŧ)ƪg)/ͫj 8LɹA$M$#zw(Ē 6"eZIQfB"҃916P *05"HWNޓ/= ̓87L @ ,C2,5λXBvf{up5~cW_aHa!6ddfiIHq:lifEduUZ{A@ zp`!Sr Bj&j+&o5t'*w9y^;NWx>o;Ơtu2rNThV{t$<+Rħ\\DT^]ŤF,I^3ˇ|EE)AEY_-VnDWqFP9'|9(ʊN{󧉴TiSy]%29CzM*%yy BNI)Fq͙g^z:&ZD${+=pơG 6 둾pW}zk?nGJEsfw+~7.DO,ZAy::o@ܾz 1Ol`Vy״Ѽ}}btY?"j=_fͷW EYIk=(dI~r0^v]k!ǡu7~[ ~'0*߆Sa#7$W7u;?xPtU{;hjڅ{Ol{+EC 6;_S-?Ak~ Rn&%F#5.]mϏ/::4IrXĨ|$ +՞t;-cO-Xļ ѮaN,bbl!GM-eCmdkC{fjӯ(HIy^&x-^/o0gX2J \s#Ivg˜`J'mѓCQ|}YVgsp\VٵZi1?.vAZ=(𨼺fbCY(fp5GLgT>͒rLU ;_'a0-tNtлJNʄiQ}.4/*u]tm~lav]yu?ާi鑻z]i3P{yU{"\&;k+>]qĜk~W@. 󹫇(,![J>&ω1a:4ܨPTڼ/ǥr{ 0R4QRe2wc|vq;zwV,gB*3,z;ġ9~M\XN7ۗuÉV5bm]: _Mgͥ.{,=GTҏqr6OFiO9f]Ǟf7r}WK Woh7 _Wy%M%pۏs(vǘzBߠsħ`Y7:~vr7lz?_StGo#OWS~{,mQ=)|6_ymh%z^I:#{|]Ǫ*j˨޺jڭ,w! ٰdѢt댉ZF6M=J?Vrb(w~ /}/rߗH:$g %p; DQAx + I>7eppFzY!jp-='Mf}UdG|΃g6o6'롶pbxFyU]/p´MTDk auk;辟ՄdxK,F? NǶs^>\!{/X][.Hpzg |Mȿ^ z2][İY K]p#:VHz?z:4B.m|UXpn6,OkBm)C9Y`N8%pEsA,w|4˯|bx~|]Z{IKXD_u&37-ץm"Ңz+B=a[9kY~A݉k#I֜;JxrZ|7[f |O>R#ӾZ^ݾ4%yFk -%ӟ;+]IUo'#gg7-/ں0c:k%V.6ɴfV#l;~O:l藺Czаz"~9 z\2{%cM0qqFV=|]QK>RyЦ@x>ޯFYXo\v6Hq]=xtu+vߎi%yj9MDvb$xW8O{Du.bg_&/Eݳ؆-$z :+oTFZɣliZa$2m!dNZ Rh RîصBE:fZ1ցeY6B:LwoSLkaىWIôv:UDΏe~̩c?)SњuMim-[ NݖֵJҠl|g޾ݭ[z";o #OIck& k&w=>aey}˱6*(Upq8NPo qL-wyKq}p2G]r-/ݎy!-+f{xկ[r ?\ "]K0y5gַm YJ4/bL6BP|e]]):_Bcƞ]<^g FS~cEVe2uDӊܐ1$dB&gsڳ:Q,~"#Tk\Ꜣ\H*B(q! [3w\(4kp>Օw6=T]KB%{XqRvQ৔1+uAE2. m%3 ՟Պ# qr6Ԋ6|{n͍Hw2Pam鹔xm({l:H= HB[iywf6}zǸŹv6y&Ǵ(1.-aefհ14Er{`Oq̹b}U+ea6$6jaoPHcп;ͫUxW`B Bsˢ杤 ?C6}V+p~8G!Srk@hVG0,7+%']v$bEa%f[z+"d^ #ҼEݾi˴ <7---o?uH :l 9ܞl,sY2'L/z!PTKzI4N5iW-r1#`w|v{.4rYIL{u+g[cr}?0f!iƘ{ Ęe`+wf{h J֦ӻ2R1yUܙl#nAMGC3QDP?Î/BGz8 Z UY!dZ L*.-uև?6n w+I?ц\,eyv lŠ<^6y(3}h[>yŢ}⻻:?:UW]76ӛǪ{<}jgn㸲0r1gBV1S@lD<6+aAt7?w Vm^6'lao31D]Kh,(v=^Z֏L׿ƴa'/< s8K+<{|qΗeVѬw|5LBla8A1ɑH`󻿵ZlTmú< wa5쭿WeYK}X[sѻ[%+M's]n?o#rOp}<61/ƛh=f) 6riyk,]FpAXn:6hG]`{SW_D>:P#x^/ZVxs6iOKtqK~_I'n?+=OcN/;'yy~ o|OnzU5Ƣ5U}^oZ~ۀ{><*Ozdױh]o}kRA~ylRy Ln+U_|q nպ{֕}ei C{go8QBN4c1cDXf"~ֽk x[ fyJtS[&9cfCD1%l}?FnѤٝ/M:!DhQ.ի;5s٧3Ɩ Nme蒋v,k@&IB$N6(H@@@$2R@O@ ]~KVD7Q qg9w61Da $2q" \G4}\s/eI n I@!$I A!8fI$!,Aa4M~6mv0mq.8'lH`H>HCEΗ EBIRNא4I_ʴqP! Hw,J !&á/@$ )${lY $?$;WBcII@IɲHt=Hh!!4: @Ro5{?Q $$M!$ $=Gh$  Hu(˾!nW:Uf~^4`AG{C-.j\D/*BExL߿C?7kԷJmPPd[I.16ycAj64֔}B>mmyԎH.ͧlXUBRѐ fbOuMPs xi;4 Sa?=o}ک+D̶6'*5b6 {tΨR ~%]^f:x6?v jƾa *PbXƂ# 7-[߹ g4Yںz7ZzNS9 ]\+~׮pZrkY{U6^`\}uvqB(%8$ g-QZ Hzz;ppq骤йeA<> $΁4yS70b={sQ(#Cۡ;~v*M !P ;(&i17hkT!X3P,L%w54H4QIeËO j}*U 4ɵ 彋0#9B,!$=d-=$?͐Hki#y-~Y^^k}kװ\U3<^ujll8icTs>IWb+ F^n3 Dc)HRy <03c2pvo;st9m6>x*~ He l]c6RKKa" (NxC9_3Nϟ-XBHʐGUP9! @\݁bL!z_O,,+f58g'VDݩz]5~yLoj({ ̫/; u>zSQ,mWX53<+: ygH:=sLU9=jU>ԥyS|D͓y?tFKpuO? TR] Bi\=1oG6qҖ=o"@\ewݺp '}5H1A̼Q2"@(FXVxvD]8?Ӆ C 0[X DMCKkJn'? D} v? #[Dy)[Cq5g[oqIď!k!G wxد hT{?:n B?YYa}Mn/.AX{`p?vFd8VެGCG7k?>Mc}dz:1\^n5|1 o/9~=a`%ߢSsIBS ?ݻ?WcU(M>q䏆?`2I}W5]  k`_pV<=/ lbcn6Hѝ U ܿsjԡ?xf!( =??ogQVv?ޟO`,??/~ FEwAX{ZQ~Tں,?_P3J;~͗-_9MutnpϪ}.KF6Xi5xϼtnVVxޓMk.ng߻v !73nGfZ5MKNUCT5m1[ jٹd]=g2 4HBh ߙBbG|nJ.}0`ݣlo&!#I1H)0A¬) bHOoS'(,j&NBZg#ֵjֶ2چD8B#8 4t|}ƽUe9Y*B$#:hѫ(~y# i7b CIvMzHkɐ5ɍ$@RImnM碀k9k8OxZkfHb $!=IsHLI2$ OI) HC ) RL I! ou߫|Hs )8ZNOxI Ύ$ :@[$|w@IA! e$ 3Fk!!1ڀ{wWBN>:|b5u[tpmI!?}Oj[ u f}.NCA^P0[ m a =i ycÐ^I}֧.~IC"N <.$qXOQOtd۾=K~MĆl=^JK'4~HGUVȒXpQ䣸v^\|/%^NhIP9|-;lxN:?# t sJt=y,[5XtyC.L?kr-F&;?8Fާ߸K2ȪkGs_Ι*lX#yL'㡚Ѹ~W$Qy.q-=ȡ+˩Srue)Ψkd,&:\VlE7?ӓxiJ%Hlcg"JY+;`Ʉ!!/gBcOM9trmR[uzu$zl; ۺ):~~gGWྯ-yɾ8J+r?|,|dU!if put9P+=-:J()쇜zJ`E( r,eM)dTҵjĥ =F͛h6I"dSk!3,JDmDh}ڎZjAVՌ&ឩ\Byx Z/Qjn!א"S˪8nyz~skeOom49!bE,͸NN(F ƾ+]lOZ/~]y)u]=I+UvBK9DQvҋZhK1CΞ&wQ'>1=vB"кzHg05K 2P ܯye%^jd?# w})B fD%ب0)g K1+P{ IPĩ|W`_޸a}i-C9Vn*$@7 c3~\T(eu}BGH=$ax9:j?N권j'8=!%~}TQ;amB^i,4sǃ}D&Ev25RKKCT3Vi@E L[;TɎ FD9QI@%-V4Exǡ+ט)hكr3S;]'"TL0 ǧeh\P41D2.G4Q-M AQԽ6=10xRf]p Mi+T,',I ߴ\NZ[MW$V=x4XaVcl@-ٍ2jmbVagK++qpe[<8E(Ɩ˜:0FՉωPۧa-Zh)^XuñRvj  ^AIئ^ڰ{RaCx,_١8pvo,]) KhƈK0u{S)m|'vJc-ddW~oEZHMt fp.PgG`P::N |Ytɗc&M㡤Hpa`$P#3քT 9 ".£,AE Dt% "F$Y7%0v 4pB Rzγ^/|.zw= U/6?R? ne@DAH Tm9%q.<@%vl2l(aE) B(H2v\l6C l)A1@b,(R#A&˶QsM8ÜTCN6e FI!HOB"!3v l(cKT,P ,C}q bLhPda)HE$Y ;&zĀ`I %Π¡%}9x䨁 ,I)!034.I_r z$˦:-s-@XIR28vX` " g t>";i1949qID"bBXؚBfe (C/emmgYM&bn:] q|$ ,$HDf́%$*TR@Rj'`+$a rs3$O$ oϠC &ލnw(%Q^m]JOvwuz׬øS+B}[|k3M/|=X#?׸&S̣k *h^^Fɺ4ŕ6܈4θ%5*8ĹTb_".]֊q~v_yŧ~p($H>nWkwc>|VB> 츈 J $<99Zug52 % <ڻuX~*6I{2w!˯{: /NWfiggdCLĭ7өv E7 ~3;?<\y <igϸxC"2Mua0e2f|,7~OFVd3|uTu^6bp-^6Z4 A!P6g4`@we7I=,sֶC}{#0?7Ltb|Rhik%dFh a bAmd azp LWɝ{{ѫ }#l[,1@74߅[ ڕVsSaF`vkeze_l2FRӦp`XQ@"t󒣕_^(*&G/O8W=#C?Bb@}%;na8mH>kJw)ɟM7BתX@[p!>(73?wZQ!a:) ' 3`ë)5a砊2_qT'^&H! zQ!(ld5(3w5=4H1C߻r=W^Hӫ !!G+7-*ן a6m}}=tᤄғ)D Q;]B%dǐء- ^Q*7:Kcx[gǹ# DC=D<Wߋ=d-[+JoJs;o)15Cŀڧcrj JLJ% `E1XIW}As& a@)I>bԦկX˱b͚'4̝A=a@N8D%zQa-gU$h=1XC#p&՜c4^tRWalfrQGy!xPUKal㉎zߵK8[ */JBy%B97ʫ= @ Kar%N5+-,pn-P塡e Ȱ\6iVMֲ+6 _\_~kGx!@Yi"])R|8jU$6G<QLJ| u90}ъ<+~ ɍ]u>|e`+|#ߡ=CBڶ<~~=~OM6ND;?Y! !ߡ=?ݨ{^âgO}o\OPlʟYI@T SU1}Jp<Cy6O@,Ȱ?ʖ$S|qLwl|هOW{9~O{2Oӭ]`35'frγ`{C')ʟ5am #n-O{Z>z$ 4x鳦nyʤ_/Sócjr5L'IΗ^>>扔3Uky"32QP"]oޙnxVgv g O65Fz:҄+ )42/}J W-Os $0i `|IN|zhc8\@0Q.(-AbKcZz֥<}_:@^᪢|:p]n7Svāu172L@. %Ly<<%7}4wI8dϬILۡ&m"P#sNY0r ?Ȱ=MxYŲ\{y~,aS&svOax|y[y trN>K/G$ yr m$ʼn8U"O/1k۸h#A.B@h#0 4 7e<7M{1k !f-OE]Nt=.(5K `M}?^TqaL2iQ BxCM`q&2P'W4aĝGS$+i㴿/s` 7 Z3?dh$r14yi݈ 61sFax|o o3"&xw%{S{r]SMNm3}(Tim^#^X0[6>wmD?1<$*÷PM` zqB2UyD7XAĵ^BY7~sƫm/d4{;| ~=֝]{iWMsS]xkeX)LqLl)C? skm < c8bC)B+<z uAߐq;Cv&byo3MyaL@0BTnOd-ECol 33/:;duPXo(c{2|BadB@@T&Hd:bȖ{Xm@|>SWbK>-k(,0!opRxS sxDtÛ )a,:")i6GEQ@Q:"ǐX r$'Ԅ[8dp.?0.wwmn!Q{@㝀uD6:L]M^PBqb(g siUL:vaATQm?ŢbmbLg#.AC" `x¼2%t' DeV*:?W~OO`[.++G{{ D%_ÚOx?}|d- }(fNxE(Cw`zr~ `;P>p[md4s c/$dgmÂLg? M //rԡt.nԸuk2U;\ wWHA]`ù/>7^ F8sNS ?İ"Hv'mʺR,ˤ$sI}K } )`D7dT6}= E&BjhR8U3n'{٪M#SpG2\&7$&[) mEH)TU[ m!28?w<)LjP8p 8ʫ ;u` ~I($ș?{`6Sd#@"1ڜG<]IS۾2x2pc " wa`Xg`, S{nUə% _M8s<MaR٣Q 9 R" #%T$vVRetII yR#8xzFsTF`ߣ_i|ҩe3 Uۍ6=/P=cĖ8JdTiRd/N*)cN/Yuq 5?2X%f o0סSɺtݤi$_,J0hA &zJ̑?Vuv9JWN$x^0}J04&zeL?sIV+#YG鐳x0dn]PS`li(;T,KG"M% 7R`j&@ 0 \=@].&$nGw{!/|c<=aJ1A@GW<ߛS/ 32P0(|I )N&~OJV{5v^{&8y҅a }̈DjHrx  |R&K C /_< sOOU\CISe/ueOr&w.,OwE@{yP! |7}R>Oћ^,u6}zq/qsm]p7jYD^s>X}} JabE M[8{uĞ0 J]{ͯ 0F<`QbX 7 N]|%߬˺hj\ԪS?eϏQW9kpVk#?qC`+l"M!: (Aa6 r{dC5̄: z$HC`zV ft,$3a|;Xfq)l;v+u(jf 224dQcg#?X˙!, I |mI0'($ 3S&d\GEjSmRQ骐"@"~yc5]jMm4/XbAs`u " D,mtb.د!ᙯPR9}?槲k4&@2>A GxKpXևn7%_8PrO\ʒ48Ea*sC|֣n:tW;I!]X01TaO ,JCoLUJ q8848KYTغm9[T@hه$d;x 6bcWmS:Ti꿟oNn͂*V9ņ<M5C0¤0pOX̘Y:@=E }wzOoo]o=|!5i<GX7C]Rm!-b/ܠ.g.׼~ڈat߅$R@XG3 lI:>{ $?;{=b-azƪ¨@LHc CPbM9jtV>B&Le~͒Qa})cf+VT%DX@"DDFg315|xmJOz(PgGM1_B`\%?GzʦZ$1_P8<ܗ_Gs}0Pպ\3?Q4YT @ DmbbbN*:qgw,hN ĦEcqNME`Z& B=Z3doUP!J"JTd\B!cE2~ C܋e,b ;ЊC3#fæ* '(g#RS\L1lW94NT@#,dl7ܙs1b$ DLkQm)󔦘6*c8푬`++2,v!tT[&W8ckk% T,-f ֯;<9daJu`$݇0I)<$>xm;xO/3JćדQ,B1q`Ř`Ў)+ga9h`X6mz,[R_:(BÂ>KQi94Cb5̺?4:o}&~ڎiYe"ncz2{_7>L ׋b80Գm>  mE_u?~c|vX@PJ"d"2E%o8Yܿd tI̛Kf=p~˞3}ytO~Ms,ZO1Dp?ŘFY5sិrC( Ȁ25}WVFY2E6>YT߈ĂRFBhjQ wW2(e$#X&$ A]vCOgHQ᪬u-A$:*M4( ekvY#?;I*XS-R;{qֲ "5ji*dAZcT~}T w/-d*6A\O<;`X"AO?s;OTXC+ƹy.tGÆ$-|^P0 qYtPvuzϊL[b<݄Wx#`J!k]$FFH#?W Nw}"jFڥ*u[2&~uDТJpvUGlp-4Q{*uQk7;{}7<2Nh+U:t|{8/uؼ[2vEv|~SJ␁柬Ä|=Z=aIs&5D'{E|+"l- C(keD1>9"Xd1 aե:w\HC'D(H'æfvPjHtڷݺ`_݈z'YeP@gDuVw$VvqGz]?+w*i||^JxCdZ ;(Ua&`,=Ҙ˖.Z©Y՚EDGKs<|J)_# 0b:$q^L-J8Fg{bour+gqjg M7vbT;f<#LX*\.S0 K*7%s K v&-j_V`  /yfay_!)˻p G~(dEq>8N5K}n}Q6rll`d]7(;_JoQax uZ-M!wFU{ZJdq 4~L\^ pHl]DuJM0lӾE?վaA!riӱDp;v  7^.q,ThPh`Ca~"|p?o?jkYPئصg(=?KT\ n`)H`و `%hS܍oAr_nRq4k/}wSe?FE޿6~<"-P \HX@ ,q !%'~[*C !AnϤ Õy f˔KurzÉ$R]_dz?zP0G]$Ę'K jm&ywlwd&MZAm+]D wzהxzYI[ I3]a. ?G;J a#v&8ŽV8(vn;?7 2קoϻ۸_UYvt, $|; WN5:M8l")Π=>oo=i~wހēE*Jw)mT [`zs8Րv辮pꯁl o篝:+@:Pp~Ʋ9ȹDlӖT.RP`V]I_tXF,P#{LUs>)*w-Q=@jc:nŮ5㠷/DGTaa+/MUe2 Ĕ !60gqv{kZ?P2F䗫A̹" 15,?;ו@hsVH$E &6gXԠhV+^eJ?S{x!<Z*E sq`CcaǣՒ)9 b ~\25n:N Z3I*+a:a25֤Zx<:U(vΩ+ QK+4Aبs̙5=L7j9rZvgeIF̴حڧO'h6iLnٲ YGC麆<+Xw,=[iv3X ;sj 0GGO|tHcD+ .>nwo[h5'CȪu*\sO}a=>_/^F4"1AaH%B` ,#&@HF %NSePu05™VEѡ#Btwclpվ0d0J[2&@E svjn`GDWM0pek9X3XѕQ<2 j9ă_ҩ# ڀ ^B!ﲭsj1lꁹIdCdPBj4- $6'ͪClI ֳ:6&__>^ WM<{@ * "P  $,!0,HTBh!OB1;ԅ04I'O[w:%͓D&9q ?9)Fո_GV7?`aGyI;VIkN2eu `5$i;HvZ~>, 5,Im) $TI=bh՚>>ׁcAJ-,w4uh_XލKeӠG0-<^s䯴&j9_$e8 G# +Oǀ"JK!{j8+r8 qRSvA>k9*-dܙF^}{][Wwoda&y H{AzuUZ ^DHŏ՟RGY [\;ODb+B1^o&e<>dzl0rOJ6>ACIdA -(f]J4S|I =OOe͜`Y$Q_uS])1@NURj: =XAM8$cymo`~0]R♕#V$)hͳ1V(^ǜn0fG Fp-A*LWUՉ j>WȣiA6TG B( \lrWs?Oo(ʋQVaRdr$ tN6q42*I/ږL!EfQ_1 #D? ͧ* l`T!"B S}Qք8BD  hӳ5n:CLJ O߂]|ni]u{f'ݷx9 [,"G3wVw =sc,RXIXvgX{?ҳn2&i uIq1xɓw!@pD`v+dL\%*!IJSSViQzs/1fFUU$*0\c'Rm~&?~N1eDDD}H7TV %{tu_{ nC˅Ǐ2| : pIpBiorr ]Ԙ *Ȁ#;gh˲E.2 db?x AXyG ",DdH]]%.*s^WYql9c<3fU.aD`xb1p(~Ҟ@mR+6cW{䉺xQU d.BCp "ܥ>ǎ5/ ϴ'/ӢW`Q\`QPʴ0QO!?^WɗLϵ{HiU<e`Lԗ0$>*f{Ą{7`I%BB+쿻6/LbX^I2PB `aX0XCmTI k ?q (I6 CWgG*:@8&XKX!8KJLT$4 ӄɀpDeeZUq v tc]u IBLK3enT&_E9h! =S6ʶoyU1oQ_Do;2̼H:(#||k"7Þhz|W5Q'm4_Ow!.v?緊O@7Lk@z\Se(=b( QپK&UվgٍZtj)ޝ?[KQme:ܼ.rutTYx481ZzwWWz9܌'œHi?ծ·@TZX=߫R02-Җi4@z+^itOC)@zކམ Cu^I0fPOgf%5F$ZR߳^7z/ 0!޸j^_FE.hGɴhR!: 6@@,HJd^T$9߅|O}g/ݟx L68Èq ,ïN1:: ;ey=S?5*VUkuMBl:|˪f_grr8#'7UW-$\?RoL[5ޕ}g?V3U{dz[$O94f|x{6g !)y|׼>&}t2g6qy&;剶yGal@0C! 0b-&N_b2Z8?cK%ꨰ9O|W0V]_S.i;yEO=?fqfD: >$TI_e.\sGVlԄ0:}שwE1cOO4a!"dD@$!o*/Z\e]2yYYg F&l䎠kC.[r#R ieb4n=MN:QB,s F_\~_~W9GPVٯ!ʩjCnHEa<Ѝ}S5ȻgӰ9 Dd;۶t/*WUa8۫ p[]u+Og=BJA\^.Fێ$=gcٛGt+[ߚ\խ[F5*x11Xpprg`npY!.V$܄=^ H p<@0?Cs`ٷ9"R,5i&@0*7N%*(Iؠ:=6)moIe-}>-J}KyYዥ FJRt~{6^kqm0W!Ԯǫ%fO!{.gj5Y m)*S ז/ykݘ " dOD{:2ء3׀a_80W0 ؉C߯?ܛ]]QK@8졾9T?ٺ< y6YZ7Q{bs7yx}*qKWEzeh3ytyUuD\o!B%VF m/J B'aAIP Ed)X{8Odp?S&h`2mײNﯹ;۷0š@J@k1RDٰ!vd°HxBY,߰$6nyϦ<^oZvd!Be2,:&H$]PJBdL?$%Ni|'K|ud7-$8~%aLf_Pxd`zC|6 lɍoOM׹v;,x8F2&g/$ |vI47NӣnIʠrM0R ?I結_I둳ve;>߉t,`OS}>ጸ^,$ HF /1N8LV 0r[ To L #gzL5 ^w yNWN%O>Ưw}ynM6Q)fSʙlo* k~Rj).^x\TpCqL), Ga!"*TBL+VkiBQ O`D= PęlL ^ʉjQ?a7ovw?#q#?cz`k]9ܿ b}`TЦ${="\8s:)t.Q:)F2ͤgw+|0TV2CGCZd ]d9sbr>}[ӗN"_[a^N-I\|]Kat0vm7<]#A!A퐀`}o lP-(<D! Q0p>9|_#"`duXn6:7U[/ak7>{cu>^6JgDҰBpOc'qyg=,VGⰠ9U8o1yK $^5/G?G.`lr?p͈?Rd@_Q& gB-Dp~/.y0뚷}ey-}ma7F[wt8QO6< :Q#L&Ύx\K j)ZJ(Ǵ3l.gI'\l7 [J6 x㡱#2a'kXKI1_-q/XKmۃB/*MLGR;]M5Bgɨ6sI@Ԫp[ix&yUv!fbBdV5iȺʢo1wimF&NJAbaCBN`)zBD3gA.*)I\>ݨ/X*a >@lY`kIf IX.jfs˚)8&' ` I RR@G|49B!'hI|Fg0U\y([zŇ,A]@1 uX|e[i\9hLIAhY}<Y5㜞&Qr~F*bEN9J"P7S.,\X66J*jwY>*mMF(nґ=aXHP8ɔװ#V?rF=<۴ssXQgJeXԖpx? Ź5HBQ, IF;63,w)Ŀ֚7V[+GM_)zeӰ9Zo yW9%n-7i;u4O;+~Gbt@M$?B듞mބkGaYN)V9v5o?,Z.Zcx@^EmLV ˳^IWaF Jp7Oސ4+9x_k]" t))Wy\&4я hLTЖOr:[ x&"eNuȮzLl 2dɍX&& %"yjK_0ck^KQ{- BA2W*C fbA*9DFRRD=Xl< ٘}9ퟥ~GtlkkWv=Y-C'gyBL1L"qg:K5wJe@XX`KhH*D (wp- &q;F/jSp*6;+tM?Ȅ)9;L/ pEv~Z~7Ի m׃C]xTۃ~kTfEbD#>=?(ɥũ֋ݔA00Caʂ|46Ez>#\TC]Q >ܘ: aR\Z0l~KN2'pܺӝX |b)0H(RSK"lyҪR = ERF iv2g[dQNC"..&0%&p\9Flлc DʑA0/?G8&$q a3}E^9>3/͏eVbB5m*Hr26rv(>'޼@ CeUI f~mLgWO>X0sSQm]>i{C(N"ePR6# KXQ+ŴJuAB'HڷǰLlEGϽ>Ó0ɍcxvh^J'xͪNOǽ.mi1 )s5q 6o/I5m~{GFK\AX;Z~ :}xK}{PLJP??F΋Zz?&<džݻ!VEV]OL_7lt 6Nu4tjcDisr➄=YpBiCn ( ݈`;|A7Q=߲JN붵$@'eZk ]`v{=8nfhw7${r";SWO?jSnĒ^'ga¤>!}*;U *"wUPQ:nfyޣ,~{urwOV`lO?/O ?Z!6rǼ`vS ;:t]6 kc Tx6MI@646PlY~aך^G`߸Eh'ɥX͛>)g3Ǒ,!097['?.&`#㏿S'?٩u+1GmEb&a `C(gԹ 7'k0Cۥt34쯁m m%Җ qh*|_MNS)(mh9q C XXFj33umHzvͅq_{m1stHҗ @ j_QjJp_ }dzWb2q0mZ`,,0;Y:d)z-sy68~`AM $GZGbhuZ;kTVD!򓅵4=ϸo趞,9!߹ o}w{s.'?v;L.cݙc3aw5y%z:w[._V S %$uiDSrMWk>y` 8 8Iݎb'r|p"`VVYG)+Eua#y{MWkz߉ ďsoea__{ ɳ^^ϜPԪf9խi~1 YІ2Y%w~89 cBĢ0ymu~7|]e˶>KWMWJU@Oqh椀P bX~"E|TiuJ*{{+8Ku.lAy/7/Ѽ4|$98$C.~Wn7}7y~7 } 6[)))EpA6R̍T>U%E_gwA!EG[Lm )*E_G1ωTQrap8A0yC24^\yVT8bT{41JF1i ϻuu#۴:U[]Q 0韩֨k3l[ 6a8>y[ӧ RD tl z`BMfuRE {?q'wvV}~lxQyA&U*)[-z|SdkPkJO0莴Z4SͲC~J0`lz=+8k*Mwm$\L\^mO7iW˯̂>5C}$yaE3޾gdl{'"I_W(i3?_T*iPhU5?hlMm?4 :F2u[21{aO{'*f2ulZ 0P"@qz7 &&NYyDy-krͼNɞs<â 2u, SF wPBjC@aMBH d㻿bLln&j0ĝ9uC")=nw[eIn$D&MD[Ԏnz2"*!h@B]-iQΈ(gw[z87'a]}ܵ?h\ng]9~8h2).(y.|[{O'vyހKcv9%* hC ciɑKϪ&{_ӍP%jILP3R|u~e}G =&jnaw1NVib? .]ݗ[, wS(ӝDFkD7o(D̻+Tyf[|+j1Kq* D_gr1I/;P^/CqGfAI(Ǜ<S,X`b$ eڅH1(6*! "D p'׷”虞,f>q;&`;J4(B"zm\F0YUlTI[^˜HK-ST?mzLk|ňa 0S8q7f͆#skC$Ҕ-5;}ER Cҧ˼Ę`#6Vgq(9C72gOLtX2-xuZ>.mjjq2ߓ3+ GgAj,/D@`~'?y7jFiMyDNa˰΃ԙj`};w/9m/~O'٧y~ZZ?~I>M)3jR޹T7Yz"*ZN"FhQ 0 D0{+ivJ9J%L _v.c`%_hgfl=xle= Wo391ȯROpe}Ҧ2o&MFQK>SDi^Ƀ[:dt'TO>aL ڥ_Ԗ[bFu3g{S55Ct۝sK܂i(,Z8/ ~Gȗ܋6- vJ<Ư[FŘ C]Ρa 3mtN"$@+ڰe!a7/r"GDe$X^G|_A26=.Rj(w/72gw˻x1=u_$S.=SFGK㞞*im Gp0B'`q{kygĪT((>c}ݣ+OYxFyVRu=G_߷Ь)}DŽa]c^Ypw%=0()L~}w-+B݋{,Bu}:(|!TZ?\Q.)C޼u{c=`ϵ?AyY3hBAa $>Wgu s~{_3o=Fd96$Hm+bt;d9Q߭oC P ӈk*dй C wr֡yi2" ns%5)B /V,{zN[ڷjhDy#O(0l8K ȇO jL4HHƔ!?Y|yJn >:,d"^.BZIfE, ,UQډY"E-_k]s=72LP [)d6?Bi4Z{MBzAK(ґ&#HEDU 2e ;Hv!_Cˤy=<ҁ*FHƱ<:|f}M[?y& |~FcY]TW2qTacqh}ޫٿ^4&߭i73[kf.m;Edb?1폙|Vၨ@!x'FtafiwC~uY1$ ˵-Q=q쓍 ۊa!Ѐ*%H#rdVq0ps8\l6nOa뼿]o>IPI瞋7k`@> $JwP~ȾcZ,5]Om\u$;ޫ8q2Hsbyt )z-("؛@qEbfIJנ~wkGM4<ί@E 3Sf()nn|%nV?Zz 1 6O7?2v1r:>$ns^Ќ;w6?f*AhCϾ8`ag??K[+IF#R^MGCr `yt<=q322ՓgtO?Olt \M@$y8K!Ζ|*!K f^COSIOV̼vQ˽cvWB8TCE:>gWsٸws[y,39nkq^@[vv4lr= 'x{rpR@ٽ  Ex: }{B% u'rjMi\WbqeЉ4PC^`}?_ A͏gtɢ{pސ}w7z~Ssȵo-e ϤӌHQ]Z|Sd}ϺkVPE^m6f[_EYiu/FQĒ ^X.K>73nhBטb`PWiqg-gŎH: b(\g,x$~͙)H(0E ucW) N|R?M!yUI?n& \(O(ϐS;oHՋHrOhj1[5ʨ'w *G_A=Ȩ063lEҴLF!W/~¶d@|8  oy uf1Y9u[bH]A6CD&u;-29_2$/@+'N;z17$y.1pG/sWsh3CYk0%3,>qeշ/-Uz nߝ!(.<E3

ҡY),~S# C~Wy|}x.7Yη݇U6\n~;[7Icڟʓ=XNfp.«*29 (w}}o\[f~Q_iy2EBGҼO=Bw7HŌOm{C߳(0B͍^.4]BfBR8b^SZ[2gfnHEYW0xH9MM\іppBM@! ! <._sT "r׺1nLtN%]hKGɏV 5S~+-?˚,`byw끣"q WeqAa{t*nOxzp!8~7Wc$c6D[le n3U1}h"@h)ɫVߌ&W%r8Vξ>^o`2AA J`aJvtdI]'D$)'y\^rQ%>qE vln@ABXM Py :b tŊ+/S7X!bFrpft&AoP`'s̎.&6c\it\f7== bH/ZX7}'1L:XWt^ܥ|ړc-BZݧlzduڥ>jvMGxroO$ȥOP'UR}_#EN3o )Gש0yNG{J9dtӵ^ JگICV{c#E5Pǃ2=19 XLX|W A!{_Z\4U.iw{^a}6GZ90&|#(#.2R$6\dvnj]hWwjTx:v LHl>o~CA FGbag.,"lǹ8AٓfO^ڼg۵ LI1Qtn8SEl}#w8M:R-=N`ϫA,*6K|xvQ'=5='U53VшiҞni"P&W򰹛6ϵ&pU?K4-85!6B ৈ3d {uW;ܵKXJHn&5Gry2_-E fhYU.1\%z3{[0ŎJ&V6YnXmJF +ߵu`E iiҕZrYhd f0-qJ~U  '*I!mo.^6 9,4ۥ>oL+I*[8'RHvi,lgLvCF,a(ПكE\+;y(n>] she6GsؘqBaa\m (T7/KqejqR/>>`+(75NqV6g8?N+p9p6ΰ~ƙ kD\ "mHl]-.YcB?,ԇ&,j^[z^/׮7ǔc!= E/#Us{8HL-vm>vnj64-݇_M58 |PNi`^G6X?^&{ yO(2?Xb z 2.~2<BUZ)Hvp îAShDm%5+jQk@ug2/û2Hh7gփQ#iamK'HM&|4(A83U:a4Ep+@OhێK!l9|<Ҧ0i ߖ$}\LK:ι C. srx7"^%i B(y~ZR3*؁jylK9}px2_xQG ? #Wy#:Gnr0Un)9AS;[9A:s5]ūtAV]IY#Cd;i7ҥ,zN`8LrP›wMiއN: &:OIÄip<t[7gקHsv=Ek<-3 Y_jଆa9WΏNIrE==:\eDqcݼtu.:4ɵ70tGDAC8܉-".@+38vW-ļť+ ʋY[-VD}62Zm﵌xR֗8kF}_"mf^}êG"@,]:V Mوa HJcK@_fH<ϓ?%O ;~_;VSd;̲Őgҗu.}!rxCX8 WU2EfE$?so;LcEܘ.spϯBw`tcX91;TiJ,9?o-5eVZVZR1e$x1J婣HeYh9yu$>jiJyS3FG ~kB:DKե^37tf2~C4<^u3qCq5l ?[ep}KUqb[/qHO+_S0=WBp^[9zyþ54- ilk/oBwNJW~n,>;0PaбT<;nj04 865T`Gl_9Dkor.)6o&vbLNuzx:OS2B ܫu-Gtn'ziu?ͯeɴ@~(AgIUYS=7:@bA sC # ̩k,'. Pgw+y/7,A8`vK2Q˟* 㘡(DU'=/o ʷxZץ󾟇1oe7G^ڬs} {0Z}Swjp\jz)4uc{,rt $.(2>lt8,wOqt_lcǝOyo×5SwIdRm~ՉcwT XT8+FC q 0y2RЁ57nagXiML@820 &iI:~s" c owGV~̞~7V蕴hݧ^бy 'ѓ}{BMÎ0@! H:$<~T<1#$KsRϡ\S!U&*)\ g'qwѺ@b5Uf2y_^\r/KGG@ D̼6ӳG|$_DȊ9 &>EpQE73I@u锓1kB2"gH=Kap4W̢TUsF[^Pu)LMf0M}Kx-J/'K~r/(JF§!S*PD"8)@OP']>eel~_hz]}xfk*h0D`E=΢ OU".G{R\G_综oҺ;0LhaՅ^.?P0~f?}vb=mք~'~?l;$ 4DIdFq'叕NxH5TqqNQ~W_}w̫|OB٦<7OIT=~@UM)yźl$'&0q0!d͒{{: ϶U"nslms m\<RI|ܷ:ʉ]Q}ӻ4пlF}~jHy:y\Okn?`z?@퉈@/DDrs[xhA 7%=kr4x01bV;v\MӭՔ=H, 4&:5%@AW ?2km`~rSSxBx4)lzQ(ś@|Iot[Oa(i1o&Cfy^t׬s}uc =Єޣ7;ԛ*2Jje[1MN@ly䢿_ؗki;hm=u,bKiy ne~f5[h;~e Nccyrti3 bx8kqOB/~aL>uQT :Voeg~BF=ğIRȞu hM( ýdrz~qLkȕJ@ Y1> &D} { 5jԢ{?kzt\LZZfA#xGKHh:"%^I?qc$PQ`ge, %Eo>,o]/(XO`!O a9#$H["S!B}|O^o$Sa #(F"Ee8?ЕL4O-a[Hzg(V}?1؀^7D")<~@@?,BAlo&4tneFMeDy{kݝv؊} /u~kx6C9{/]!=ȇ1Xi` 'ĭG0ńL@tC8c|pr{~;+#A>o+ku5ΖhCvn(RHYb )"zU/=WA;=Qf|7 v."<*TsEL c #gJBJT|4$*Pl?ߟ{ÔB.OdǰEweZ3DOx&}YB0'XHGA0xpRF͔JC㗄K_Ay<(oEU6s_o1r5MSsC>x3D0)}* 3v3vϵq?}_;Q 'SjP>NXkNU4~%Nf#p5FF+g#+'"S33BFi#rM@UDpԈaB0;aCmq\~ˣ"Md?`.9yoͻ>=n(sǍaXe%cZ JG@q!0IY7gloMgs>sCUzEG½g{zk~c< VFe~{K虫bf\PH/[$=9 6ɦm \zy:L+9HԴA@@ܥ1V'EzNÿ@4xBkAq-?AE!xmoʬU,,+D8}4m6L 3? zaT.*͸e_+ŏ^YhQ*B[oQ|^_`yzc~mgƃ3f>_g2 P|Z#쒹z1Qb3`,:KX0>'甼vt@0ٶc@s7K?J֝SkKg\T6GRFgZ^Uhd! C͡A87>8<^H~1zss/Q}@ȖO^H3νq,H} .(P6&#?|kc{1&O"9)$-Kf+#N&<V&6.f^bNO v|9ek.o뽱X$B\GrDK  ͙RU8НF%(ajr##J*$RQUA{%bl( x>ğtSJ\隰&4/Iy,f*rfA |# hlJ1 ` C LJG Tkj;Gp#bcc#M(4)BU1kG̿? јwa/0~Df6+۳"xƯB$v Xљ j-A>:&_q+N+Ŵ-csr@ix:k+!>l+ BBd!Fadr|M&Vގ%.]/5Г|u QMAP*J;gQqQ}5^(dc'bH}tn':RL%o>{y8ns;qsy}i:=ifE;JAp_9`䓄M "; "s|ȸ-% c Cє+0AB`Aj1sh O@Kb3d|Im~+pu"v|~J'd9dm*/d0RMXdH`d~Z)Tδh/#}+<׾4c\b#{E$IyrUi$$$xW-dE}jf&򍶍|`nD[ guzzt\tx=.Iiu8#<位q0I$ୖ@e؇~>~߈9b鿻?Eshig@urN߅toW({@B?ht>i$# @ hQ:j][=W},xlv|?=OTSV+eQ^mpKNCƷ3_z ѱrgCDUPTQ]uJ3t++Mfofۿ\3Cd$g܂42!LOiކamlY0}([xX9N8QEu]?OL|R/o@i?#vK,?I 5#Zyu )S$!/Nc!1 ^P>4h I#+ kkgdk{l' 6mj@dmB-2z5){wsual 7nQxpHɚ{+dVZ.|B8 I>4N[cxg!;Nc@N3'R mM?Aҗ"Z|wZZkfh<x>|׏C֦Kdtw5[nJt2 8t|*+,&r 6if| ;z_M5KҨ"52*>)PU،pM [x?E]>br=Cc vέw&z}px0o]w(aHag"0q|UD@$>K>:f\&2v;~fnoa3ff?pڒ]D?"K @4$߾% SN%Zmu_f%  3 ] LAr,c Ttm>pq" D y7$y<Zykz]zcc 1740yfABdk1Ivv" )xyh *:rt> ?XS:Lwz6vMf~Ft6~dY L# ,Ik&{˶qOo~lHHQ=8 @mn,YJz%%FƲ P{r#.U#v68޲q ppuuL.cx"aޒ R{͠S!0  Y-NKS}=!.'kN/qQ@]HhE`!+,%uHu캛<EH ,ELFlcc%ŋatHic @!IAl۲++5 qMm63[Q!ʹ$hM\#!$iO&{&HcݥhK'#v;3<^I;}U]"ſս{y ܥѦB[D3M$$T:a0&E ٕ@+Dwd:hH{ -gGG>^waixU[wR{dX%edg=E0q^ً|gy;dbUGguv^ܽY1ʳǧCjOTb=Z,nF2dt0O<#ZG 0WCpp $0眦Aq}9B arK!;8.r8|. G^~zN9<#'@*['MaBnC 'Ha]KeUkkggickja}(Xaxg!Ljx7\y}?L {ZZk\>z--a`sRmp;i߇N擫oXo(oAq 6g~gy?00;OUhN\_/q¦\{Kp{F}WFBOS~:8<+8ˢRAT D:}uNcv1\Ihջ?^0)D$P˼O~u.GJz㸊G|.;w^>BjeڿK폠s.3 اMx+7j_% Y>YEÑn VLWb\]닻 N1DBj%?ujI:whcD31b-|vO?|˙i_ 5kKҽ‰=cH A==&\ ;IDO5,}AXUqG1 ;;z;*?򃊂YHwiC`߻05+ Hy9R.!ԁJ>C;I͌G Dz ȳc*L@ܙq7xn74ڥ&쁶/H"AQP^B,rT]uO0kZrr|lS'ܲz7Isӭ{v bTv/p vL<,ױ> ԊۦjTU_4 L'(9h k ÏݡsiOS{*5)bL&7aivW9-ú) _q hs0(xٚٝÂ7! ,)9:J3,t tx6t( wp: ^7gsuޏgIhL2d`h'%"+$6$CEe2A" $cWe,`/(QWDF?ԡeNʚIE`;_orÛO=3gB3]u&ŢS TH0d\cD4jn h(zڥX/JT<%Q.OFѨ3{&rħuϣHC0JΫOQPQOQRRdɓԯFK? Sg2|\}f2Z)!mNC̹Vsӣg~}ݖ <6ԻyL>S+Qi{!C ( 8 O w xMU{nץ ,l_v~srS&H'M J8+RՔ*g^P"nO0#Bh ,6L=sc*nJ> $s% eBu,fS%"|qBYp@hUT896u2Ѩ2n}Jw0n֑mhM6E0̉XȌ?Pq* 1.\y`׬9jAz== #enr (}, NzVZ|MZVxgڻ֌YBѐPz RD? TqȦ28qV0$ A>'DK[VQ੸uI1@0)->G[ | S57oG0C-FCeɧ׼>%o+!mv\s_W<MQ@ 8DE%CCE==MI/ks@|@#N;I ' N;aN$pz$Rt~wG9[=A CMǾi]eT3'7u3sSC1.~?WO/ܯ}Iw햒GTDJP(~%(&:Pkd(_߷lØN;qښ:% Eq^D+ ׅ؛p68< 2JpHN+p%#'OAjѦ"8b1ag=Cbf%jkisRN7 θw̲Ą~ġYSmm=< &< CF+FǎP?"A N ˝Uïp%It\P}9{=IU73[v[M-j::!eRH{' \4Rx~>O*~e jDb$4\̤̓|e `e2_Tm#?q&H@R4 Rbg!ytD՗9ZV7uxYXs( <|3;ǫne ,JZ? !P^hBG+a-gTk b$ L) ə2)>wͮvPCUt@4:)}{+}o|g[8:tx}(!$@ {+~ 6Rx.۞Ǩ:vp[ԃJ0 2T5[%C 1O2 qىCP~4a0.} ,{Dؿ6ʼnf +K]8"4 ȶzAHyLkc.9DR 7t>ƨV^_̴5R9Sސc#a^o%(@GDU~HLr*7&N7m`~M<ჱUĘRrIvUօ jb-jmx+]B! 9HLהsM?9e.Sñ]t%2UJf P -^GID?"#,G!L 4W?" f8@kݭZlm m`|@SFpތsfc7}[v6$FTAcwnT'_]d78HDw?΍AyHw$d/QXm;T.;|'Γ!K-TseQ d^?{q`msTULI7/ aFΫxݯD!bQZe콋xM yfGX!j W}r7",isT^E+.v)( E /4w?՛2g>FRdx<$IJ?#a8y),A@@02AAr]k $elϛtG [2X4uq+k.t}``@A=pSp}#|Y{t'`gC~r烿Ixƕ;A ԾձLtcsӰM=}Er꽟/Zsr&vʩ"7H%NC3B8ع<8WwzDV"08 .oulB7Ot[6:_Jf_74ƽlx=VVzjPǂF=[;_1xto_VT)Od+"qeփwͮz`8壇9[F:# 6rݏE5g,ŏb<Σg_YGR`eXEh9bggٍᒄ|iΜXwbas246j:5[|a\"}ӂ3O~kC\ *e/g \XjڣSݣuOإGO3.n8&.0<hwꕙ>44auu>G 3 lep4RE UlҦvǙUvwtԴ::HR!fv]om5]_r 6kTPC)x ɟ=w=S߼N|Է<Ӏ;76{-@Pb+`i» {}9uDr!eh" $D.eu34l4j I*kf4Oki;lQXڙQdN "Ua8pe-7VUT۪n=UBUO>9ǡGk}qJzʙ2rԇΞDGڰp8E*MQVި9=VsJ8^sTLhM4 RQ'@ q7'DY4`& 段 U!̤<3L Z4܄$`)}6<32X)9vG_gèpGߥKM ͝Ed3'3F:RZLg_G`ϿXNi-FZ(^~R's'1_7ae~a*1V q&l 'I&pv*'>d")( g7Y[}9| nJ:[)W /IءEUwSH,mT=%}WWWkUG!O yUU=, 5W!_UQyztPZ4Dkrm)_ucccU[2Zuב5`>llqkO>xf^X˭UF"0c.YYIn[FUƎ;+W\ a+\A0,,+BVݥT qJ+E-s.l˳a:gZTi较pwG.3Y86hѵ _Sobj>޶ԑ; ;URlE# mnq'3o`npkpk+0hxutPdj)b ;8{:' 04Mi5QhCK; U82B*n+22+7;k25_2rjlrp,>">CY5917.2ɺ*m$9ZA(g4δeeg x|Zk=KQ.kv8R:fi9uoClG${YwF*-DHY7Iƻ֯z͖NSzl}6b\Zn|nG lm X6qt־ԧ[>soc旮ٺqEBԻ'VpQ=}evmuuv^Kt9TkQ99rrje-ymƣF5x0 êٱ tf1v+vtwrۗ8RȇwGq- }*k,@O_hִ9l{| `Sr޴:7fgiS\AN;],71ך57ذd11gh}Smb1źNJJ4GMQM79wn Mܴx 3e5Vťm F֖ U3ھ.k# ]ۼp+-弮Ԯ x5<:;:-=;&-73L}y[dñ L jfzOwY r"ԝViPߕ̈h*Ȕ2:H:DL#G+Fp{Pm- j`m[Zq.ӱ?#JN+ %7+\:[qi mM(hQS>|歕C&+m.)֎gʇ;pnæSҧڥAen9TBٶخKFʾyeWb_Mk:yX9]ry;n5͟<:3'TV(rZN1mk--33-XYqKX\p۸йc]^Sދ3}igBwϳq362Il;HpDCw` .(څ6\ҫoQmkg%ME^EYwJu[a׊tʡz\a RONsuSfm yakŽ8֗wuksoWQx-uޡ,ːOly' <{] ovx-ҁd ;|lXZϫ8888L (4/+.mKu;{rY 9ܣ  q܂G^wz>}+=*/iuz۩p?U=X1ڧ7Z {Ai?! Je٩$m6q;KY: +q40߉E\,'DI+O\K LBauD*  m67A;ut$i{t?1}otzs/B|ݍ\ n;ΐ!)&f/>C#mv` pm<7Gᶃ(q(Q;!ys&P;ͺt3ǏkrCgj'g~B%$-TcklY8/Tl”$iХk>gɩe<__ͿB\ZvCӅtt][}o0 8 /ɣL2_oVgA}os}g95I]hJ䩤$#clm e~陟M|ZŮ"ޛ[M3ݲP@Tk CcMҫoSQl2Pp\IfhYX9T94v=fojkOýI"+w1xrۊUUlD|30(b^Z~.NG݅Hql4C˺A+<΢Fƫ4#5w2xt-Oi497Si-3n(E.g@#"HWDn7ۛxP_=9♽؅[%^~׶7IY@ET]MqXk8KV9*PYYb[J~110MAp?mfQtg,66ka4ÏȦ<==(S/\c 7+n])i'glIhJ(&&23zl=atoqk$PD0Sw- zY=&bayA>U.*o$[L$ټreUdd!r9p^=p5 .:Qs))7^ѹwPM ;3S8?w8ס Ll/cdTP[MpҦ>7LTdbOnq:"zT16K['\u z#lfeR~(訫?y)lm :YiVS9L(˯:|#O1(|줤#B 3t-)A&`6dY="J;&<*;Z"D%bTlS+oPM.#6зM#U{xtK1V0nRɠu]`oD )aWLsQ膇tXp&i&gnս{-DVR^D|e+eldK"R|4&`?Ca`kCW^7\/"wxkAEw4nZ5C.8?GJuǝI{U}jO즙jᢠWEUpR̔R[T5NPXŭ7)Zˉ{#v.8Tr5QP%hy:B!/B}hW^Q;togbu ˩/&霘ւՆgk$[E+ÍYMCo8.[nQw39tn޾TٹGB6bI=Ks6HjOuTq4tijeM,,,sM5.ׇռ ^H(8}EKԳj4!+IF垀,So}Gcuh9*sPpgRc^lKұR)d6NsEQ^Po EdNT`*`:4. \f-t٫ yFw/r6ƇǴ#FIWR⊕!ʝ~^]@'CH-_i;D%VtX_wGm#ؒR֘S{fg3v `'% ]ur2puL[~2yTwZIYN{~ƿȐ\Fay_a+*d~ ,٪n^% En֩2fFfeK;]@2V&t|aeiGMVJR\8y.qC *k[)E'8`FP4맡~clSC[듦TQ'u .m)ڽNi2MKMJlu+>p֤و(xMtƒФhvض:%"ĬM^!hd{Ӟ{i??%_+ +a{._Ȥu{vMw9zn,.p[R&G0é7jFC \ ]5IV PS˕xN[Fut7v]:sIr).UE5fvFFFF"J>xhF{0<+q˭pmQ^(9KT[e |H/T*qǬm$2@c\g: _6!,R\nCsl9Q8=HʛFڪw5eB*|n`D$Nn;BMrpc.Gͷ9&a2JWWT+TڪI:HAᓹ-Fva_׬ 9Lm .ySUUSr8]]f]d_X/iREP 58 MW@!H+ It܂fefMSucSs+5B,Ƌ?ES7ivԛ .Vm?*iZYhѹܩ rށ]  fK7YPm+4FWR.F{֖)ƆmS~gtZO*G+O>tV-M:&};WJLp,k^)%$5ǡ ?;]LdS(xʘZKN6^08j:9{#ѭlddd\<\ fI;AR>QuƍR팓IPtX{eݼфEe-l gq6f{@q5=i\ǰfj,k0z:Zz ZUjWv)r(armpqa 'Ve)&*:ǭeǥbVsfuMZT'4N.ƛWkc?>t! 'Ü^vheiRu&Ӕ93ϳ\q!4)/@#90=PLP2PEPIw az-m5k;GE*QG]0hOa&˧ e9_9HfmG[8ǭ.f0YoCrLˋz.rJr\^,7M l+~Ł,TiEw:|o/? 73SEޗ[wc_#%צoK.|5)4yW sLַJ T'r̓p饤q`+ˣ*œG?qIRvTܢT˶JmN}~?hZe\۳;BxG?T29$[AIiͪ--w9?Mױ[NqXډ(YTi.METf"`@vq%MsT榦f&&'ڗ]C΃7KY9 csJV֟;VUCЬhA M5=W!:]/r&*ruk$I@d@Td>F &EC*t5|Nc=Yn6Ԝy>I PzᰦoNs̏e¸c^ b5Zfe s̽9]4\sv06O;:%#ֆA-b:YtWk5}tv;q=Iai}JcQ܋H?#Ƭ IAö$zkl$9l蘓8 mc$DNrvn `zia]Q9l6; Sr]DկɚחFAu/vK9kVǍ MѓƳϼ؆9Sbn\'4W1e kG#U IAZK],Gv>yvbUIZHv)3Mqao,hkh$jxX6r S9KVC*R%ʘ3sZOU3Fy,~FùCCj.}'b!^4\qxl&nG&jYqlwqY%//exYMH*^NS 4,U]6BrMMMMLCcMH=)S*гKdړ1S7wl)^`%n)R }"O(28*j@2a|/S5E>z4p y4R͓77ȹbrrcq_sik2r˸k8AuSUaG7G]I upJQd~1uTj-R v dj &VT;5|c702+?w{z(/b$%MEtn' YP )ֱTUUSs9dsY}O>N"?60xh=vjwJ.-b9²#WdK&dddKQy6A"ewv8159P&!Ѷ5]b[#Ay|=J>E Z \7@נOI:]B75.%-)*]2F-,ci6kb1\?Ⱦ7zb7~LLhev{1)Ta}\VtY=`J?Qc) TC[MÊMMCNWh?O;EٶsJ;i!<569,u =y?{J~kyUKUUUUUUUUUUUUUUUWW嫪UU{UUUUU5UUWUU^W_jUUUUUUUUUUUU=UUU˻{⪪ʪUUUUUUUUUUUUUUUUUU_ǻUUUUUUUUUUUUUUUUWUUUUU__y]UM-UUUzwwwwsmmmerm6mm+mmrmmamMma$mm M/?e.˿xB?!B!@N@#~uo 6l rܝ4`ܯ 3]gKzk7.am[PVS{[o7ߎ,OFhfu9H/yΪ>T%&!$8⊓Hw; OA &}BN n U9,OʤP~~!X73gNc{H޻.='& E43YWp퓹^ȏFCgn7Dt^쫿$Qϋ[ܬ.$-+!0Mnci}^.O~.o: (1^xB ' GxRl/,?NC1JkIZ$ IDqz1'5ńXQEf3ߖ >}B`J3Vw['OtW_ʒ8N"T&d^j,BYB)T!X܅*Ņ IRV_EvD5'mlEZiFxv(c]kgmAm`X$%SM 4nӱ zz{wNЧ9h41b P LXJ0F: Etrp-kĭ2&`A vv#T rMfC (gU7MӶUi/v5Cb4K@8 "dP"Rɦl ɒ_6mNt<k;sir1Eӈϩ^/5SUJf 67TTRb\-`'KRKS2daD3LOgdcnyߧ`C 7y3/4qsPvYe]6_۱mrei61<>YSYoܕ]CC{aa`ڃ g/lȖ y/cGl%#< ;yS5P0?,5˥3֍Cυ!!+DВg#y{^^i{.KO$` ?-_ܧ}BLaYWj~~k|2+!!:LyOM"{+t1.=$#8c~I K{mar2*o%rxuUP?QmCy^l o'3 IȇADWpCCCCSSC_r+1153}z>ۜL͎gK[[ RCd ߪXu~^qhW#/(~>Wѳ\G)siiVYev+,,U6lٲߥf͛6`g'''R?jN`TT_****)΂e3F^$I(+lv7q7ɝȁOIHIv&=nKڱ=~]lw>+ggmMyL _q>;+7dQF$c?AKZonVoǭWJnwBQ?4[6Xڸ̝RYk;|]tM?c[X/gI?O0a-IJj5nR}@C B7\t'UUI oş:iM;NV^> B_YGco$7w6t]mTN:::9sRuުii\}䦞z=ƓCt+z AGة.qXe8]A;àvdr'4ml{[W{wg8 ҉榮k˰UImҊ׋N +ߺv2_/S,;::9w.s Φ߻ +WzgSXgm_UU ?^_snwuCbUP\LLD<:ǻ hk(V{jERϚUoϯ7~=C̾3Wi̙PUș黻{ީKv=5/53_X'ua"NHb 704M4{y%Qzz_;)*˗Ƿa1=zm |:'KDHG < 1UףPwjiс fO%yr}\jkܮ.mW"OJ;C(?Uk4ZhLWd:wN~|w?n?SmTTP?,X((/ a8#+Uppp[]E#Bn7pj&){b["'m+5|qݽD'B;Q9} E8(X&xxxwxxhm K_ABB__g`ƞՅ{|ϔ6v>x}t=rwExA!X6UUN1L Ș""K""[[ͭ= ΆX%m! J++JoAx o.oOOF0^(i\\p zhy}o3/ styLyyjF*U=>](>~?owO&iM렚W~ 004Oi+CFD# zINZOT3:bJ77?WP挢rǑۏ_#uH?GXCd{h]uIMX@\a O3ˁCB ݒ[[WdáOqr ._'SR hOx?>Y0[,dKs e$QF/iWU]h/S>}~kn Fǐ sZ1v\+je(˟}N/d6?.5dD2 ~ B L1+ѕ[/([m@̋CpO1y;e$GCi3~bLQD&ޟ+goxHA?)7/{3?qDYWfA0g=uÃK];sya^lK6?zw}וQQI$?^O!i@V̙QPt:!Tyt~~b{i/=,g^{gQ0XIp ;PևJ!JKڇ O&؁>ѴI3٫c:}ucwqlș{dE=~ׇ!QEDi_kIf-2a2t}o_뿷F5u r99׮3׏TAS!H4lr8 >JM'ܴ;Dvwߌ_x ^!6By  Gux鈲hφ:_'JJ474Uݖ/0\mׄe2vw58K/T߰Cof?z I Tp 6mu*:*$$$4:4cGX6;ϸ8Qġ۰w79\F²6h[Ll KLPSP;@$d:*PӤTՔЖI$W}!A5 X :j$F,VG, 񵁼hi' +ܟa 5VrW ZU((8>GN!9k13N ʲ!i唩ډj׺SR:~Iug֡hFJ稪>blv" @!() 6OTySUSS Bc[r5gNԜ<^VA@T`q!qA8YI$# Q.Nqw6j *)gFВieS9~ú:xP7>nw6޶_N}?t|1} Wx N`EnB{Oo1$ܝRWŚ*$*-+ϑ~=o(|_VxRmP:fiJVQfy~Mbn^v\:"PMPFFCr{TA4^ZATG(NgvNX͘ĝ8<,̈́GTjFADsI'ה BWlse>Ld/`j،DNΈ=]*fZ">&(AI~f#] F} XR[tix<ɒSW- E9(h7Hg4E)1DzFgFHFpPH11B 'gLFNTUKv@/ wc]{P׎45R-Q@UR) K[`Զ9wjW1GaPbR^BOj'45LAe `Ԩ`> N<( ݾ$1!:p#"GV#ic5F,BTd^l*p9N`P_|@da}Cq@GS/ߜx*Q|r|],;Z 8)PX)bzb'Ԣ@e&o[C28EK`,^TŨAL9˜ 5Wv~''5=?k2`Ŷ7l=ZWQr $޺>׋ <@$8B)*R^:W; H O<F W9uC6S9 F4w F؎1^uw2C--L锐"ojɘ>ЇY縠05?Nͺ꼯b0ͫ `VZh8c1,Coȑq$yNzy;{1, }{'s_w@Q,I}N c$Wg4.3`,8Q>C8Qǃ.H@9Q>/ǒ;vLV%I%'F>_'OP6(<5]3\ 0`/FχХ}q)̀46j GV ԅŜJ DŽu\j+KdSLJKLRPQ*vvέ<9z3*s&NVqOg$)0Cp̂&5`J```͚25xfFpaWJ*MCX":c{瞎nf?;9x%;$d2Ctt:M@+ ы3[}FOFN-0i!%tAg0]?)lvw,F7G>!e7DcgٛPf~G$h htN01@phgy h \ Hi`RDBdl VT>bqKg, _ѹ0!Cğ! T2tsrRӴiLOB\* ZTjTT]=O.\4r2OLb.,A E@ @(F@]E~7 Y ʟ)wyF ?NT9˪w?=G%P;كqҏ{(:pb`bTnje9ΩluUh"V 9!):*;xԕOoTp,CK6"d5n= }T[Zofaޟ|`um0.+4[b`x,|c=rחܽ^XN7HOuL*~ =w{w墮 ,p%r̰s%e[$ڔuȶ-v`*͎:S:9=%v&aZIk[ &39L`7=$A/HMh91vIV%O+޵b ڹPz D;7$OCqo.n`cnɘ.o]İkұSe =G,28췒|}x; E#|֍78g`Q@Q<~bd ;O=3FY(0L~/qUa-%yvLȳz&{MY ES+A=_Q&ced& IO0RLܣY'PO,ͦO&O'<_cgimǣo aI·r ` ^4ę@*Th=4Mv_S%2zgS9;k`ʃ Ӑ,,\LX@zG{g$ qjsXpMcX׆mY:պiedCv\xXT21A,!m#8P=5d'GJMH,*ǒ$=WpOS׭~_U.%}*Nh )+x@(,Rax8>y@^y@I ӏY\35$$1Uwv3tG0qh%)TҢ"R$;ҧ:R'',Q&7]r =CG,/GDK_h6*yY=b\UW~N-, dB4݀7㵚7K5GF~$,ޗ"#ｷmcrw'扉#C( I2L2d]z!խYU!W{DddK2\)TG bFgay"y/ ~ƱDMpWit~׬%N0$! bWPԸiv{D+FŎ/#DHda/e8BFGG-遚sp`1Ax.e{Ji[> 2fQfL:Լ̌Hf\aL+V)r5mxxó&Ha!DoxfH(|' 3DH A%ئ(VŮ&]SAj&@PCaajh(*+ik+OVW$F 0aq (kS!Ƞk>_DH*C)u yU.J`r^Sy~P@0> =J1,-Dq:!(hCVLa9;[u8wE3{f%tD$"@P F:ߊ)$BpPQOPR,RRZ""CHII܈a79lxI9,E""If+{ ^W73:pdN7'9Nrԫ%"ejԁ<)C`IvݗKE`#Z˹]␅]2Qqz=AG+/yMjfMQ =xS2|(/A8-Cx5wO~Y cSфb> 譔g<Ҩԛk]5b-H㥥8@%z'~JFqgh6OysS3e(%+9 3s h]RK_JK@J&T-Nm qM^-ZȘM1u+ s_K*;kD@S麼=熉D;3e' yhVGCzL`u} 0?rx7тF;ҾMouoOz'Ѳ/J_s Q\|&|dO1ug?:VM E JUU,8:/gC^GC;^?&f{ei2Y)03A~vwNisbUˆPI+2 BRِqf+Q)G A.7yTSGlꟳ\ߕv"X4X<o_;~ʱFRrOu=^L>!9L+buzwcby+-QB=B쑙 oz8ק_ ÖDʳU9_)B~į`Ex6ԻU8A3>+ЧwdHmx _rd&; dʱ -ol.D$ "Kc3*BIA\U(&**(*(])Ѫ !(cXt` $Eؼ+s44PTSӓ 5/gjb֢&dD5x+ $Lr^DۦS3x}oA{7Gq{#tgwhKk֖pk{\;pU={uKQH>HS"C@uOqj`FGR>䍽[Z}f%$ JR {D Hs~yAJ0Aqi|-;$t'%e&dIL N-aXm*团nN4ĝ灸<ؑʾ-Qw~*$˻Hnr&4_Kzf0l%F⅒)Te,S4Ib~_퀕\4_iQe7+k0cY$Pm@!0h`ҙh  ɩɅYB8taCCM $XB̓{F%G;kpfg]P:}~Ǝ6գYwvW_A?Xy{el>u9yԊ,M;ZS<1GzTRMKD0~9 ྄%J[̚_D`F -%a@%LE92 [Lj4(͇r#?]i3 D#q_T"b6AH/\zbX"kq4ND7uh#YRӭ-Ӟ1RMdv `$ 4NDtJ/d&rk16SE2o(1`f=vU`˜ o]ۊݯgaD, r1>Thޟ<#NmHwD٪6.jf;-.p粧0"aIRXTɁm3=f왭Lgz/مD*q^}|LbslI%knR6~I-KEJQN,R_Dl;  b@Qf6u֭\lհ q =<ߴD6aJՊ?W^ڧ{ұE>Z{!4 >iIfb@mUJ'f7JAA=G{=>wݗ>n?޻lYY31},́OHlXAIW~eY?wțT"kHPFl/1Jw'݆6%.>!CVwV癿`s XR3uCMSu^7Ld<$[Q${ oQ&NƯǿ"!%Rh?N@ Y?=rcڞ몓(}S2FOפGfrX 0&o7|?I agڏY_mYɃZ}Vl@-@; uV3}%?{ܻuµ5 ]uHAix k -%i2V&cMа <0bbze~gTO?MYs[ ?`i%K_H4h`^oX!T> +8ҽ|qؑF ١(wi߯v+-nd7el9H$Dtd2>mYo+[kkC L@ fo}:+1^ mvkCQ\Qde" axkE/bhJRHOu(v|m-߼ςˑ*zz)1L\j,iDUr|oޟuNjvBlXwYr4EJ@! S|ݬ.Qp`h(jPIk6Ez|YV7@ygL"*#' )ߋf/v~;܅QxtmM?|Nzg1zZv4{Dռݸzc>t?0 \"y]0j0څEbmr]F>`6:IQ=SC nz}v[;adT|% 2~_M}[/af.N~ʾ~N4S#i:ޑSgbGNv*NJYk[usU15ajۿ{jz 4r6𠕅b(\`Hl&~g7f@ 1_b `V:!46svD(2h)!d2)<&p,ץE~A8jY-C/`tN/@B]"WdFHv ĩ={ML]|:W9}'L,w5.zȆFQu9,/b}*w8\.9S KM UֳJxې*SrcRFLa_3aY?N ƮNe4M^ce^Cw|]-C7C#Sa+dCրRQ%#*?Qp&6r@ h@!D.B9.Y,.!z%c1x,yyl0f>"sA4--e/欜!/x8op0K(Nh4Y| a~9 pH}xsw#'rdϰ?AbFA}E`g(\ "#THt ZYZ=)]̞MZ,zH!KIE] \}}OQ{0Rr~ܫFy2䩜7 M8C)yyYpyHQ'L;]RK>꾾|4ϥ{[-QGkR@}~ZM#)2ga>txxاZśg&@bABMܺ<[o:Σ-DФO|ާ񘧚bEA\4&,̣Ӑ< C$"\vҌ(t0 =a D -\]m}6v٧IJO>ˣ*Qg(&m\]EyR"9$ ~?q6|O σ$V\ 4=M\I$[)rRR~[A+$2ICN&3`ʰ"w*'$=mG4L5O]6Ẕ_m/7<1K.cs ,YD!Pm,bLLK4yw%W*[{/O҂seh%;{>}V1N3wVy]QS,NOr)9U1SMU1AGQSEUCAMWKKWOUWRTsPB] 0 AK !7$D?|:i;~ڃNu sD.zi:D7Z14UCUMZĽ 4ŕC1F0>`B6GZD>|*LA[v/q \n;#24>س?y22@6Nn^nvD}]-m=m=fn4<$n!] 2y8}HewI1뵧@-BH/MJ{\oضxbs$ t؞a˳H%@R'D+G$7 &Q `eb"c;er}-??Y|+mg4z9zG~^C#(mWV`V7TÂKP>198qI0$pvaŻ(]=+ىɋVɽ\dVs-2ZF\r=ݪ"2zMbNLmB\tWh{_n ~aG"C( d}ȟ/JPyn8cb|/_><W U)dUJQ`)WбrDv+`ȇ%`A$s)~7@ sbrODd* *BZ#?r .S:3*Z…AbCegY='"ɹt+/{/<* 2x-5¨s5x$-T Je~?Of&JiF= ťO~^K0)|y*NNw3*E1-SmuN !}l <uR>}|TSN֨E}R#V-zrDPAEa3WBX OHp+-/DEa8($nY{ 06e31e5A $İY5֘J)QUMG9n*~,HAYJov@T<5dx7h1|x!Qyv_*" - YoY jB"Ύb~ A& +n@)[)ukuU{h̙(tCzvC;ק{!ݷi{~wݿoJǓGkEڲ=%07)U$sUҡoZy^^ñςdP=2&;~ ]cȧ˥$qUss5}m.kpqN(lҬ-~O Fls}*3;|_lH]$E`wSAA"b%^Ù?K_+́Tu5̚8c#GsT/;\a7)Rǻٝbl ;ZQ cWXd V oy8٩# ڰ7m_,$LXoNl4Ԣ& Hr$K&4`45[xR җfjhɍ,$+ %`yy[020Cg5gB u.8*dD IRBCn*eܨ 1˳՗ۅfNfccq&HoM3JYb׭0J6 iqe=Xq$u4erj2ǥ3M4eeFH饊/{QKq=WҦDcUm ?_q)> yy)n~)[?:%R<"N_`-"Dms8fnv'n,|wE#I;'PQmmp[ad+wGު>WGW՛8U*G_٫;yfmo:nv-G,Ko/3Њǧ<՚wEl\,{jEreRlsFM7 |)<ײz;+3r>Pۖ&Dن,qs*]NYؠ!}Z+%|q}/m#x"ό={?s^/xkSb8x Z#?7Iب,2Z P9Q!-f8%p7ȩd>MSB5d䰤c䞂E6iZ1>Q (BP&#G-.vOfVnFfsAnY߭spn?6 w5 Ƴ!'(>Y7vt:G@: ?9\a wթs˺(6-\m7f_/L~~dmfJ@86aË_@w?ߺ;QgCyI= 1m`WXXcbo4<Yhեfb BvQ0Ze'w۞ h1Y'Ymk!]YvT{iR $j1$s2gxF`Ƒ.>#+ǒ ~6ߑ k?B/ٙn٠3/빐簗c{q}B_{,g{uȠ3Ss8[mX W jVdY>>Y.'0͂.DyE+j#*ONvq|vA<~%ӃVRҪJABD|{ݟ;/5tikw%!B 2A!Hy@\o<#ePKW/ȇ!aJod.tddwR(4OuU(/o’ NYz{OqGg6S --u5ꂓԥ[xw\>δsm:M_u*A>s/8Hxa5-ֺ,!x G^x@%R X ?-$Xm1K?^k+ܠެC)mt\}2S20i\aMO&>ɾ)jM yd2%ΪwG-9ݳO5s= [ps~۽X 'ۨL ՚1[jǃ#v.!}O?/ szv'{'ϽhxhE8Z&+$J(M!Ҥm@4&Al$A@8 * ]b$Fq&@Ⱦ^]1Dr{g&:ybH]G'vPc&aH{KkK˨ Nw /ydpDŽ  R}Bט',ȉeHU4Ec{H ݅^ -Gd8x;Cڙ "Bh K(`> Iˌ[6僘l)DDDD!RNO+6>%"U'6o*B?lZZ{4R`/>kOO)G"'WGyr-ek|8umsrDCzS8<)xqS^M(ug- ~_0`lHf]fը*sޠȔs -k#lںgi==l]6ֻ_6EXe=>Qp ;6)]((<ŕ4Y#in~{i{BuV4J(wU}[;:3Y})4wR@maI@lC>ߵǩ+aqpO(VAaZe!fQq}V5VjCݶf4"OTP@aY,/mn.o"0q^ٳHHaԿ//S[T&ņ ClBP$'dX_HCL@ h pMh8Oӎ O[rZܽ影Ç$$]>OVE-&:-9Tm62[=w.?ɰY9h~D]u&'{'Me~/~ףvV:0B Qu lȹ66^diC 舐3Msdd@EwlH RdjibfLTP 0 :-]Y d~DL+iX}tyޕm%c; )>fO<2vJvoӿP컃t QDOu#K ̢Y@uV{3 RCd&a`^ FNΟ:ANd7hՌGezN=$itƐ߲\" >\lyn=H <ִ3&(ER9T:HOAX'3GyXڵ3":_Z.:W@k@Ⱥ]έBLq!C{t p#'=.r;zQ}pR  ppTqITc(LCcH rEGY›BK>I4>M;[Ի[/,4轕1O Hr O]u[[7}p3݁0W7 jӝMyn,qH '5} w&S^{Fş}`Q`$A%p&>٫fF jGN9wFs !4%+)?rOJЊ Cu-"%u}qC4{dh0ζ\oz;9q>o]9OV]R9 #EۻLJ(- Jb@:Nӑ, "Pӱ'%= 仏7T (4P'nQ&,=Rk}db3zOڹD tW)+:~Vx93YK_~GB?5吱J:믽O59}އq쇔x$1" ! 4ߢxޘ!x > @;X_!}̐JsuDI0P0Y >1k(fQ )əY)9yƄIi&C:RTS(8I@! !L`)p)qZ2N 8. X:OU6݈;`Mpc]WZD6`Dg4"-`|3I,ˁ||Bk`cy{$b\_ Z +3:.ǡa[6<1O)vRNPH- JW~^vMM&tA$d$f%#u󓎺d)ϟ9=;¾xWzq̀b) Nwe7hJO5#Cn>n^qtQ=Hr `ILL"I8E">%L\9BJ&uiET֚ҥKޔjy.u$ĖiIxƜj#3_qC o*1X7i8iC20uX:$yp.gD>χmZrFQ_xO@Yv4=}9̰N]Rf2y%w\9/;F^Y{ooQǣѓ i>m-ROnT,!d!,Z-f ’ HijzBcA@ R6@fζơ\5Eeu?>3#pv8늾XA'% ?nxD5yv=lGa;A|Oq3t!]~w4jC{,q?w&37Xe [^J  tzT^caP#A舱HtZ#|W$Qs "a5-%mmbJڧ6ƥeeٙ(#"!DClvᡳ`ldYr`R6k)gu(hPU^f(!>JQw\+xƁ b0}$]Iؗ"࠰TO.ب_dNYA )|T . ǜkϱQM$r qNfhuO1U~_ CST_mq x= dcԯ߅iWH `a|YPľ!t`ӌh_59~'_G_YV s> |*g)LK0Y5B@Wh Թs!ΏJ Aw1f^Fs1;0!0OL܉Si э^VnԐZ~ubjt?1z1@g)9* C0t}ڮ bX+R78_c`2p2"1 U/bzӱ;#%w!TCkUEapcT  wus䡦{džUz?ns85'0$3Z,,Il0fvB,\ -$ԠSVWVYXk*h啒 +8TdVo:sDŽ_iAQU{Y`'{ I աf˸qs9}"R}ꪋW<6XѓN>WףU%צ&XY{-AYVxV蹒o{P0j22 r8}ladm q-;'{f#4 PE' ˓ 6{qE]q#]+>r㡠!r1U=pG.ƤkbGmJXIm.`_SObn86HfeJ!BY Na0)x]W"J~i^#h'o=_=?zԞI@ 1 TR5fz5߫!dI#*i2 [dnKJao H`G!$<  _zB'X! 4_c.?#c/Z=]%aT- r˭}Qv9JgTjHb" Y{*/M)=1HvM.VNܫ 8YŠxS8fLM$Ħ&iYկ4\ٷd(䚎Z Dӛ~8a-bEg2~V6͘ b}k"@qnY" p @q 8F?=&&lUJuM1B]5G&+f˕F1$pQݧTQr0P/ vۈƠp! X {{ONe&K?Yű=@ڠz{OlF/xm9P77YȎ<%'޺*wyN;}MΛO&a8X8Eg~t6Fj*Mɋzxo^E1PgÂIY_FE @ OJ@DE{jWڣbzSGZ{/[OZ/'NQP10ۡаXGCִ&O6\h6珲7[q-@Q:WP4'us$KTD#PX4&U>(?߲EL|Gχ7TW- ^O2jp^"2ԢnR|gBT/^~@#gYT|;ˡWЈfdD<E Hr@2wQAyL" o3`J7}"_>T" ۼ vRmƒs]@ E7=A(ע"v\ XP(QIl6n^ׅZՌf+Y\TqLY#ǦOBHGH@<œ p$d3u3luLr"А : qTkGq[WKbZi!6G~Mmn"&(?} 1wxؿ*WZIxƄxÒKܹ> ozuL, K"Wk4՗t:Ess?w\UJb4A$9KG$x@Kj5zVR"N/UqBu**)뙇6ixtJPb2sE ``)& Fղ@$xS QN=qy3\Mvq1iczOzk`Xjgݛչ<>h{囩Lpspp⏧֖Mwl$ qĐ"B7R_ \IN*ϣQ.VλRT,PIjg6hDJzժ(Ċ%ee:㦲1)o].W XNE[CݨAacWm` *ػرoʥ]*j&ߋaJoI?U"0R3cK8`>ܧ RetDLIΕ뭋~Mv H]^Oh9btfCR=ʫ,ҙڦDe㉏T3Wc} Md/$=~YUjrj|\>,U6o1a-VI&b֮읭ɱx l?f:Ti@Y6iQtˢ:TUSJNI`7 =[z[4ZʾuV HA\.vktIpٱQ 9V9őaD^CTы=$ZMiT$uACk暫V׆a1-~3l#_vsJ*ӻ뚬77&!j2Tѽua{?YxY_֯IC)8~Kc}h▦&/Sbe^QsOVwo3tW iܞ{vyۄ&nWw apjqxu~Z/q7DR^jbmtaSW`ĩ>rS,Swې(]ʰxߢV5ezY1-ĜΊ֋,K]舩Χϟ~K #/!3*}]bUT,FB0l4Tr dANUD+YW!k+]LwS`!o!ڨ: EI(:ȇa"boEQBSܴILE ?QlLE`da7O>O] '=fNwٶ>S!B,JI6H|]qR $<h#Owo00Y4\=r?B+~ dE:%9Oe_?*Sc5>C 5;ÀHOCv8Sl4{ۨu3aJ>ԕww CY@w)D 8CYk j З -wtH\;o&NMBP(dC y+dl$AFa@'؁w=0SZI0AAx~=t-T/A ?}k{i2S^6nrӭ LNv\,Q)z?{&P58!sQGC[PyN7(EG;XsP?}}2xORg|C,+kp(隷{vEUiy"T?*3ѭIqL~= j]0OWk¢jֶ={P cL>Z6",<7 tk4!mCjB둳b/z~vG|Ydz=J&ǖ^1辠c\Bi$)(aVOtO$ \3<-^_< bX !BĨ -1H=JGzh&V|8Č}ަb$ D8m#Y17#nO3q \S% 8>{f+-H|#QIœ֎._-pMad"GHf(x11ͦ)"" PT)ǐ#"+ʼI.$M+)EO D$7zr>aabjV෎®vl%Gi<%=W$ޮ;{!ŴۯhS)h s฻P7 &*W+FntpChIϔ7?}vcZۭ],'a&js}Ss.Odᥥ~ P|N K`+4^yD}Z` nd?ؖZ K~3"XDg@o ,k3Ƕ}QMXkU(JSjD+rc1C88ń 3&888992 .ٙ;3}~n_7@ݽBiU00դQB;=zpzNE hk5J3ZXG2E ))dn=n} gwDQGNd>=zx3h-|uDD<b7 I-wP1ᒚWBa1PqahPa0aq2Χ3qs`ǂFj k"WdGERֆcݚFbU2`wI)Y͑zpr8*Ip >sl1^oz$USp-S7g/f9gٖUʎv;1b,A!&f ,jxj9\Cb #8tqD"nbg:*2A+9<\[XPm,,o 1<9)bUwrT[dmIQюLRR* -?_v^7<_gnCx2Oܛ rFU1ANߪњ5B!qSn ii*>zmD(7l!z#b`Ш[HPdu 厌k@+J'9/YM_z2Ww}Rc_buq<+Q wGsGV%"x`]\:sǎTST,`f%>Tre<@e0~7)Χ{ȵ]aDHbD SbB6_n9UNxTN<?OQWSSlמaM?P]NjQbs&0]7-VBȃ(e#u}夛=`]bpQ-s_ﾘxV @<ybS'U?fRn e .uuP]'2sjU8M:Mjew$QJ/3y0UUNq7ܫHEad/g}}3Ѧ(0BlS>mтt S( Xha&ɖȰ6ii0ȧnZʾ[Rw]ҝrDUN$8CӏI5zVEZd))K%>Oy^wpơTQG>|; *P=?>w\~k]z}FJt:]~_Y";0G1tgГ0I8Bݍ,aD8QG KX{)uYի$N$.dL?L/L sU2uSQ`rjI%_^իs՗9RMc$KD8"&`A iZJ I||a?PfnF~*ʱ¹Ptz JH>T!o*jqU,4F)2l=x2\`Cq0Q&L﯈s8x؏zoNH6Z!z^OfзdXNqOgR(X  [16vLB& s/_jhɘ(DgUJ[I]YQYYQaaYaaTYخP1 jNM,` $8 >;)2db%69fI z&N e1ɚs%͔,m1de4ZʤjT>\ ܞ3m)Y# "28sG2 C8  +D"GRJLKǬDA ̑"]bjI!;3r#ʪk IVrZ/7\*8:qh]& U"M$UY+RmDM: B&rx+fZC3'ݷ^Oy#*jnj08̨,3j>xr Ub? 幒|JeYƔSЯv$8o5|wkL,SQ^O0]Xf2CiR՚:\)cXCA` yxz\OS_ .`w_):Sz&ªf׍IfO5gL w60 7Hc!sA0Q[Nߩ1J6х222aE)/u?EL~W,[|g7@Y~UKgh5S9 $ƕ_DS=ڋ$G`L.٣eQag^Qd]^p~6xѧ=%] )j*-%uUmmѻuf,ki BHgH(~ hӫ"'E$O35&dJqc=Dc1FJUըA`*V@9cɧ6y'Lug002hS0Cz}?@ANY{ =C^l꧎B^ ry+[pyT%S WB= ZSEߒ>wN AlL9|:˻>`9G/6NM @%fC ]m׍zxdžIWiiO5Xn*jUU>W]Zʖ\_mxevl4P;I0!P>%%UA>L(+~b/$O8O;Gy5Κq$pHLX!D< [I& C 2nO2έ'((+E .ddMqX~F[0:c[`)$ R %1V8#~g~_[}mp؀D7[O܁^y[jo qQdp 2P;n߸qU7oc\\@.uT*uuuuLN | tzPV.UlulNw|vH> 9a]4IX@2ЕĠ#Z %5]5/4!*`]EFMgY[agVi&.tsGEM8aZ* yӪp4kA; i[|~>;>*'Y}ԓIߴ=8fM㕭~CD΂gMO01}_r5AvbYߖ ߦވZߟL.":@ \lA>cI̮ a8{JYIelU`QkmlXmekLlpc,FB [EZb]RboiEW9GnnlU/-?v.+qKv56U&iÖrzK:y`]nc'M{\93hǠإ#87m2ZA6JYf[{?șja 03n9?RЉ`6\JʈsKFCHCZ B g,з,ߎoSr** 6Zw!{2s;K>W2epyTҐiaXSbDf`G>UMxVWX>Y=͌ߦ֤d:,wr [=S2\.%42 Y'l XqBCDº9͖1&I%(@dtŊ7=. 2քj|h #&$tAr/w;x;^[&q6vĉ>/ *֙4WFE:EQTף^soMňPaCIM"4!  (oSQr/_ksSёMFBXZ쩯̩yٙ0Z)᳣@OZӺM`Y9tQc\Ģu\yMa'{o_6[rm~܁c?*${.B{ʅ,:4'l xڀ$Ĝ}ev^ED Fx??bw:neef?++[~Qww'ta~QjZ/ai]&}s~r HK`w-FP0:(0W G Ŋƞʺʦʾʲzr!ҦONK4}-G?vGR ꮻRaVkoo%̕$rv>H@"*65|2ykH1[{;;=A;d;':r%>֧}>N. lE_n:]4U 5@ϟ#qUio)Td A0K5d,ySM0RȻ*0U!rdk`q@B"};|dokguM(\)On<~\q>*d4Yu?! 3 /F&$mԾ# Pkos}n?MG?I#AJm1>e CTLj)ԳDFC sR!41L"g&I/Щ۵z^Sϸ;_#'{ms5fw.%A~UUׅ ]5mSS$8puՙ?!/`/dK$D) M%u'}eqyܞ6)6rSM o0`~K[Þ~allv.;N׬Ț(?SC]=+avXOq{h{ğy~FN!@}osPާV퉓-j@N5m+uf 1Iu"X"UT-Ayq`,n"~) nh 뱜_1r+쐌OD<:>Uve' d3㼂6 ʤq@FثMա'c3+_1`0]:0$ #PX YNHƪ.  O6Al 3$J}g(NlAũzu>|L>}Zޖƺֶ6BՆB'RQ:nll*ˮ 1lVcR/ϒBcCȨUpxɞG^ͅOkUB}#[R O$萐)2dL;&2iT}~f4DuDd;7Տۂȣ}gVwwՓP&SX"s9\0@H g8/ H)qqNHfB'F4zz&k8`R>xì4XޏF:@(L=JBgA5p2+xss5Q<[p16JQA=p\eMPՕs;^¸*Srp>¼;03'd`e1d=o_p5w;V8]Y ;vv1< zNql@\J` ORK=\ @.C`8@zȀ8~#M 8mP %tC\J@~$/tL9``x*x> 7v~3c. ~]bH|C̼Աɹ 1 .yb7jI$-D%M r~:Px[w}cuhmy ;l1BfD 4wB$h-} dk|zcj"\wEA@a[enL@WjniqRiC0Hrf.-ŴAR>cʾE&k`90 a|rMDPxgoąt|sbYpaHηVߦ Xnpw7|[|{/E$ Ç6 +}#~mnpܜǝ/8\?׮9hpOzB/r؄ñpaGP$[dc_IyOb?zҳ/ gޘXY._2p c!X±b!zG{`ôߟ9=!ZL4%o9Ǯrv<602sn0Ki#o7u{D* Ѱcj @sD:"x3L0-}[&zߚ\*w4S5ÙF9ЂQ ycMq~h S67Z#l!Z~KG;6-e*Y]~Ɯ- ڶ+T(;g3QچT 9b*_&+OEJz\ZsGMmT,{[zjdHXVF%եcXđX̏ULּ^݊w/?q/)AE2͟")b>~A''߷_ m&yoyM CCO&^ EWcT,=cdJC? Q;9;K<̯'8+ɑGj['IUr!I)'^˲bcx+!g._(z@&10  EF9D@EG3=GHH_R /(z4J?]l];TJMgZ/ıHV߁bDTb=Im1uUU{e(|>vV [3A$A$C H>!=kO*K7o h?øn$.m]>QI+/!&&_  u'I ,$cM _fp 47/sPIPBcG vJdzTpeӉR֒Z5K;99CIECJϦh=/J[}d_.i3;[<7E}ugG dp3q&]ܭ%EpX!B$NRfI)57wW)##ݓG*Z]q'í3= 3 SBAŹ8HTVkI2&R, %B _N8X! lThe{qWv &.og%8QA\n@:vNh&R+AA (2qy@5xPG}]^]^P^]]]]0]]]]]]'Aܿ\\\C\owz~'##DQ.&e OzyCx?8AR'~y7$H\@8x M$p*J՝5#jxp oy6Fw\ݷ [5A=x׉ݰlHG2J4[s(dDawӋ')[o U:YK埱.ךz֊Tr<:3,=`_Pa{ uYI UdқOWWջW~ N(,% w XrRH )z'gsߘ}A^ϙ8ax3$8nL>[ʳUOST68 H^`x 8k&#3=(Oퟡd)21`@˗xIwwd3 C$/>׶@[[_u}ףf]|o}m+ۑI=uAD$B(Ca8yW*Ml y|ͣiv/jXhR813b3S 5U7V~y[U&#௒D48;|&~'TN~fWk↷5ng:dy/kpX2?!_&cOJC!Q yf3b&1%&׸ہ2O3BBAÌ߻WܓԲ6$.&<8(ס`HwiS6eW]7mk2Y:1 ^_zZk} r+! -V>AqAwj'h=gz@X$8&=2q7,9"ChE!f6E\]%/iosussruFnbdsoX/mZ7`@ I <84 S1h(ŭK-lbGȧͣ\Vp>Scdږ}i\͍Q0tgQa=nL,6`fanj< ")ⲕI2Ė$ˌ028T=jälc QyB<0N))<JKlطA8ƪmPfsl&9%lLIRwoo+0p[0p_pppppZpppp^pk0pp_p`p[/w7ج{MN ?0ar@+}Ǩg?Q9Ei-b!ё$ cnN 4";C\L>&K\@ws>x xg!G)tV9,jh̀caV#Z 9q":dss>4ӦyQI@P#  C$=I)u3qSIi8?]3j.O7`z'܇˵ EAwRj@s;;vx<\ ?'clrsNrht[8'D3"9VG&PW,CCj~4@t̽4>p-)v=M{hmJkO#Jψ :o6v4Ie~:>rԃU齱A#|lv;OeG$1Ce=EQ$ b! d;!mq3D0CV39F @s@oU-13`СK<-:( ^ܨP=a,A%?ɗOG*Yh.r[#7 +旨;uO}=֟O;ȖuӫKW]0. ,@`Œ̫W@\ ! aqcv`3#{b霘9 Ar};_\zPƤ`uw5*L̇GheULMVqrՇRI$?Cd}Ԥ'~,^2 CnmR&??/٧6?q:R7^;IǕr p_`%-/Ι_g2q)x۬!p z%`8R. "ePL%__6___&_6_________________<____A],wy&v{Ŧ_RRT@@J0 Cwkz I;lG&Ű {2! GĦc FLLmӘ4/~CG:QT]JǴ|+ W ]a$;q~b)ltorq#E;<7yǥ,gr*[?V@^zԯ|>99V$gmȬl),bC!$+)PV`UT^YIHRrbK dIɻJ5U:h9SRd^oukA7y]m&& ,AK X̌C49L *% 0cVRZέ8^gF9*"홹SXMX)NRZv2lEȶB9xL2MX|-ns,̛5t$Y] ryc '8BopkN׼2>{+m+_ب[})XBE!Y_2[3dc:%`5;e`zO~$G$;hq7aPimqʎ\E1n-\^a]"^X'uuI$FHucʼGG m2eնBH  * ] --c\ Yb qk?tϪpw {C/!R~oalؙ fQ&㵇aq@3Qo%ۿ;Q;w̍x\`_YwRFVHas/9^x̙"j@X(PL& WQş  #"'9b p go[Z2 I+ %0!fd) $1(~8&"c(|=;mÐZQ#6+ۭrs- ;/Y,nOXA${*aH`6REU2\eGy&Fid9.5B. zSH6q%:f p~T]w/ahibd&[Q~#Z`n,c[K+ė560qa]#4+7jR9a d=t1H9õ..3');=mvA1J$v5M@b4!0{˓$L +%p<&g1־rc% &0t3LM X4tIIOzM3߽r$DϘ*uy+ " eWT:Fi55la͚l|xϝR?:8^9N2T B\vP$t)+;5-`k[bDkehH{;}-PzS)6Ҽ ^өRU:niKa'38[ B"Uy1B=$&/ A+N;m:N{?C4©2$}aɬ@-:SN|C*q @(߿* ;Q-+`XdlXXHU歗K=^gKj }KLY;ݶB`EO?2ԕ0Rw6@[HqsH r8>AdrȁGi Jo`08URD@oHH\_b40BmWX$Smu&fjS{J{M| tx! D!C%<HKo9c\VOiH,/fXŸ•2Ra_5ծڒҼ5OIt\HQѡ/KJEkZſgXӫ\$g"n\Af8O{|2Q!I`䐲~t !_AZL6m#ӟ?_=AP[T᥅˫^#S6N"&^XA8~mt=/މ/8YN<=]kqukll`lppppppaX0ppSe^p`pff#0o^.lpWXW׮poo0ZpBBㅧpA-5VlR^䥍Eo={PJJL [飙3Ea(nKג]amSɩz>)A ˗;Ϡs Pb D!+t ?h{<)H:ɴ R-Ҋdz<4-KT#hͩkJΜ`RДΔrZ._k^gLMN]ݵ3]ݮ]ݿݷڲ0../ܱ[jZ!.ZB(Q#@8V[YhŔrk l{sKSb{2H ;ʭs̑¾&Z.dnͶNɊht[GQjSyl0+kX*(%6S\DDWՅIex}L58kip0XQ)HcS؄ny FGI-ư-/˻*Sw}Z&] Fʓ7ݖ{#b)]G/'G xZeIeC4xlџ:c@-}C3V.R{X[QʡLE_V*5RS_Ta`s"w'{zvcktK?);+++++++*+++++*C++++++)[+ʗƮUuM*5'x^]mocj9HB;)I]OW;?pP\q)-oY?ĸcdakp S98@p;2Xn_ut,aa﷥յ)AR{)IO#􍱪քXfeT^h^TzJJM#rZdrbBVGrf1pk)7.^AJ N#/Irq N]"LkܫR3FOA(YuXI*@40ZigpOFz? \s]$a@` bXe)U0tEOqGN`Elza\Ģ=Z,\P;, [AS%Q}3$,b$10(+M3:Qp~9"wk{ L D6;cՐ}11Ƀw"ҖY%ŋQ]p`2c8c@IPLQ0z#5u*ꐪL/\к9`~q:c*1,0U)K̯`wNK^VyHTGbA @ĵZA@8!zRΉC&Sr½go]4ORp~S4~;z~G(_CC} @ $:+^ili+j*+Xڲ22ߡYؙزr21X2Z3ZYZ[sZۓ  $)oRq?)wzg'pb<'WP\33)>;u~.>6Hv)ӳ-IhTyK) (IMFL&Hfp P4Sw_p}mp 8-!̀!<@MCؿ$qI19E)j<GF-~#Lʈ(ʹr|X8#!"<߹N]ԿbO$/+F3F0IGKKKYY1YYYYY7YY5YYYYYYYYA?Y=YYYY744l٠,tMM MI J幏qq Ծsfꨤ7(nenz/~gbjOn^g1uҎK8y>"nFHRY:0Dqg8kS2`[+Sox&/* T/.;(,{>F:oP>ߵ{~jN?>2/@-i TM4Xl2e`9榘ktIVPgf<>uHu~J% d"MGxQ_|Eݢ_oF6kQ`0P(;\Sϖ[rdtjBھv6o  J~Rcuei}w Bюs1Nv >8  98rAw9mSNA:]؂&daa%_O#%65)l]콗yp:3eIaM 㭁,ɫz9vu&wYh.nl8kݣ΂! K9"NVS" M2 ۉXAc/f }*MU`.ޙևV˓{qpFS4%V|FEW{? WT^O;?zno}U~|RV?UuQlWѬXmĢTi$]r3$KcW#`Ga30kUm_b1L#aeҭ{^p&W_?K30gγs,jwfhV${o 3NjFTa^TA!𢜃KXȇDC%'>$^[aA/^Kr0W )H'kbo#~N;_0;>}]uO"ܜM';~'숝WD#D0<8T@ǥH|ſacd5Uy-َr1'5= kj5I*=FAD٘,Wp'TWѬͰ=$ "Q fqS}|S__[̀w=+/;_W*\riHL;=yy_+)1SALWOʿ}~__ZM[ſ 9T?+a)jZ#Q-or?kz^w/X#K˷~yTS}C-}'^'D DX4; H$ lzʎW-=tt zSQ&_R[$K4*-G =-[!{vQA (uD.TCd\H e~t[5}0w＾R.SswpEiĝu%57&b 3TۀF^coTkinrmgK;cb#ccccc\烃 IΦθ¾N= pd/ `CRV˟8a*@C6h}g#>"/sZLUUEq݉` bQM+LFz28dBCAgi8MFL2c}Z?’S%Z6L/#E{UH&9! f@883Kh]B*me~V^RbYeJԖ;8~zrii&SoBBp Vubd|gK>Tg,0 C&~vu4bBPYd Q)+<,ۿʫ«;f'aat-L@#;RF"`:3c949RXD[~.Вo [T&a lI)HHDAL(;T;b&0jŁ)k=YmkvcDߞg TSgL058ݕ Ʉ"՞*ARW 0a1nPb]YWcdBş4taQz`UŖ:dYb֖Q2mP.u5W82KEHe9ʷG,4FV--E%~- #{"ˊ,+3j\,a11brN 2àiSwN}`s*qDP[fM4͂M5*AeRTȆ5fV6BȨáU(l)+8\NS.tVXamʄL~vZxmηȹj'>v2pD3HcLkXUDbenFUSdSTxM0ʼnXpa+]8dPSj*ucPRM)9yU|n*%jFV͇3Vzsn<9Sߢ 6ه>KXݭ Rd,4` F\8&j&›vڲѡ_Lӄsa(@2F!˜MDTceʼRVL8&*|TWߝPhf kc9ܱO &/T]bB"孱_R-xIhhdr.z3]BXҤ92 GruVR?pBeL:W]D5Q6RnV#x&V9~#§`Ua {ˏL .q:>WWuܷy`$suQgYG3E' f(e<^y9z>B[[:-5JERec}X>jc02S?RY z=Ĝrz$.NhCg$1ڜ $?qx ~?lկQ'']]ADpۧ-fx2YKX}g!R[_GO%_B{Fr=Ҏ<ڠ7^<" &A 90DuZRQꐺ܇s ww=nk *V~ I~ @T*8!;HF48C?Wf@DN0v߰RUPDN0X94Vu`|Q֧!Yy䚱~Iz_ZfzlWў\.ϧF,,rtmƂ'KOţ )d>;!qc@c5#r%3dt ޴Bab4$^*uBۥMe }Gm˂K%$zچmXGcLrky6\m.,[ҭjoɶq^|4QS^n43Nmi*5mφOd d ֌.eψpKS[qu]3(TEUWrT72wNv䍑˟FoNzt#xUAH!R1B2@= `WcG-掤Vm?S 旂yĮwۡPS5TW~pE;YzZz](EϏ@D\( ;e0L$- ImŌbEQ$A$(@-2r`w^b>'b٢w _ ^ CeE<ᄍ~݆;xNݶ]w>p/]]h ~r "!N]\p C6eAf2]R$,r!7Xdz Λ{E5tP"DQ9π٣V`/ <>ižRqΈAfsmuym[:r&=+X\m8oP{Y wV|Kk#.9'^'08(q=?c5?8?u">a/<gqwyjҟO2E1Jo0r2q}V>ZB1S >[FWۮai֬Tnmv~.gCߤ1z\%-:=FJ|_<ꄻ>qGK[NMmf?O(~J˷`Sol34r-T<??\+y:5mKO~_61=_=u:0r:7vzj77-Ka&Xi}L~iߣtTmvUQbuˉkOcD2i4'*0N>|}UʘzՏ}/(\3iZe&Y&UÖ렟oKOW?b}-38[ Z.n[~E}L3~[ vʰ0c(;NXT}I߸˶uמ"GeVERQum["t]B1K9:hnsY纽lM//J=-YKnkXz|WN[o7~dJaGh&34z}\NS^D%F+6{i[Olm/( e9z^ƴ_|lkX~QNRc5yZE^V?&\嫭pSqsTNs'+a?A/. G6;=b 3իPUl6ZίXE|-O"K頦mchLo 2t6]8\Pto;֧ŗPkᷛH`4j7- gkmzas$cP[խJT!h(;󚾎=kT[y/wslu lsKusMaL}NƸ<~&#KsMK3kV%I,<؆+{gFo{U@<*mIuq}ף{\)K,)ϠhFm HV[DHٜHkz?I!\I^霥]Zu{IGi긴STvsVPTҹut3萼4[=*k9ʳfAo+S3C018 W8v5vʋ}7Uq}Vǵ_KC IREH-ud>V9(ȰITn^6{aTq?)(/<)>'Ĵ, 2r a~CZ8!C Hi6bafxX졹lj]nqȼ۰L, !s> Ư2Z얚Bs|jgםhfx~:x'M1"!!=}~q7+v\+ku쇒$U'f Gob7f׫b,jhꤵӱC@W`yUb% ĢPLq H섡ISS[ZZC[]Y]^^^[۳,\d(7gҒRS/SSL3pz >V MqO|ϟ>|ϟ>}Y/ɠi <@CB (PB (PB (PBR51e.pEs,,,,,,8+TSB0a/hPB 6lٳf͛6lٳf͛6lѣ33,lٳf͛6lٳf͛6lٳf͛6lqb4k,YW6lٳf͛6lٳf͛6lٳf u $]u]u]u]u]u]u׃AA֨((((() Q\KOaYeYeYeYeYeYeYh0B)KM]u]u]u]u]u]uHQEQEQEQEQEQER h* (((((()EAu]u]u]u]u]u]xP 2Xc u]u]u]u]u]u]uׅ Ra ,,,,,,eJ* ((((((`C 뮺뮺뮺뮺뮺UKAQ$#p,,,,,,B*Ŋ*(XYeYeYeYeYgk,)\Ў!ˮ뮺뮺뮺뮺뮺q FUUUUUUUUUUUUUUUUUX% L!)M,Xbŋ,Xbŋ,XbŋwG][]Vd-'cʧJPqwO܌Bu@W8PRZ+%YO-c][ksF8;\Y֘M}EKɰ1gO?'l!Xb>Ð1 O<^ i' i[{ufNYru 8u Ia-l|#āX#^9_KRSTT6 2WA9Y _ɧOnH=?=e*+QAiy]S8}@gat\~ ۿ+j"P,>7rĀ&$)3b(b*>g|[aڙ,(yoסߝD? H,C@^A0A(Hn_ceF ?hp~D3$W:`&!{J!"ffű) (20PVZ )$=)D6 v " \S('T޾M(%Z4 sѠ3x71_ ,H :?IGTTjt)M[xP(=8„NάO[MZk]]jz̕c֍ǭ%QOBiЖnp2RS /Gv&`O? =uC'oO>Ö1utZyӇ |72q T1ηIK +cnprr'ece.l ^f,7-Y!YE&b5 ,Ȉm`_|0} j bHGSKkY]/ C2>5@6iKW>{R)D"VE<} B5qYE- 鉁۩@b~%22*"]*BZR]2m*u2A 58*P _Zw@<,D'f̽혅jZ2:44}::ʚ5H5vȨt# aJԄt&bz8} #~#M4O:kg[2C}dԙdNRhb:w:;>zm5$"jfڈ!"Xstg]]EXη?XGPU$.$ c 1Ā;`h`Ix#<uTCdhn:Ukfة:g=]LS5| AQhe$HD"H$  n\/1Hz:H0|7vua=sjxx3 fw@TS+1vT*ʏm)<8x^G2eW.y=ݾhuR 9չʭu'͛5L$xOE2Dz݂-BZDEߖ1ma@"K)DH惃IO1KIR_O!EHGj_ s\٢%N`RR耪,(BcNVHϤDӟE*"QԨ}hEmo#;0_%zdž8Ip!)岖Ũ#΋)F~eԴ6mpDɕu]"Ȫ AE3sȊ E(Enz&JH7~O:O,3?7a)F﵊b!M&6HC7uN·c٥٪Ͷd˜nFI>G=g_vWѓZ7|'ٿ~:6'|ק^sg'm$!$ @GnG 'GS7yA ^z> Aچk?16?k'񽸏;߱2(Y>`WidڠO{TTv?q* k$:gdd !]N߲_0QnGxH%`UAHDH  Z쨢{pq8SJǞD29M`1$ޜ1)2Z7(Z0O^jHtX'KfC,nc]aIR4ʄE̢մZgof:41oT~gwso4(%u$)${wĸmaY{{tĹu_zۏ ݳZܴ7lj"$HTy+~gaJ'2^BGXa@ {^upa`L<{w'<~e^B!9p'O E[(]$ߓBE۔WS'+M]ϏsyѤ_P;aG{Cgnlrw=UdT\e?cOKW̾aR*-PCwLcw휝`5E%1",*ΝyLy.$>.A5FGU!, 1iHA@c@!= NC~ۼUϮrdEWs)va%6E'Q{.8vc1bLpJ\l!}6bXd (pVݥa1zR@ #*eXp /n{V1q(v-Z- ldɎs~nBMW4y \H ]hyGn D^p4AZ*BitJ\!^}Uy  BNMXrdܭ{]:XjQŠᎤN5)YT1̗h.sBOTZ79b !cQ@?|A "yE!8ϵ\[W*ŚďwZlن]8 zlq[[o^?\r|q2_anv֣VBƹPL i$P$P@rVyhWN%g.iJ+qN9 Fv*a)"6PZL$_,B!|K< ;[)q૮ΧkO&5w1ζj AƖ(bF'!}Ǐk L oc;=Fej+=(z3o({zx&8a1LEm"vH+ qH={xvf)!`  c" ɖA'ĔZ,Q$σ=(48i"~ح:*floGƜsy1=~; ^>{h2*9^_q{wS~AQv @ +gưWWszvv]FiڵmvQm{} }鑑vT]#nLۧ2 tT OwW !|e ?OK f$I2dfw%ʘ2ooRTƑ N¹u\rWr@S2 f Qg5P;C`$~X`XfG9X%=Ew+cRbgАN~}at腹%m\nsb1FS}ϲy*;U9U33U.}}^Mlr{68BrpNA001$a @D2 6V~z ~aЧG8ef_B@$Nz\o4L<먪` 2@ksgQrxJvN_NJUqM0牵``OUg俏ħ7NDHD"Q(DYqaEEh ]'q)f1&V]i>@p`YϹZ;zWl6L[ ";(b7d1^xPsYdMT:r*?W%xZ@iLgVD+iX4N[OAW`M]/O|c[jC'd\@rH.H@GCOv/A ַn[šz UOUU[*-*Ty U[UqWp8y963'@VQwb3D(5Яr7Qm0^ ?O5I8Joa[M )lt*TGPCŽ(jP 5jŁF/ɿS< @b4iojĴVEAWK^wp-^F<GwEhzKULC2z peɱt'?E`/ktA~=^| K?KKhv&[#AB:FHH(:)$XlƯ~i"adk}'[KP\`Cʡ'gfn-26ucDr@1f E=e~a/Ci$|=<`'}g'  G)uN{6OxR45 %tuɓ- f^u1f.6mgpOgP ?rm Aq6nG%*:W aֈЃXBttB6icB k)*e ndVwcgBCHNll24x5}WVJRRٮU]k-"CĪ'B 5H?> $ɭVT/#ҍs(㖍a+8բN wG9/Ņ]ES "Ie]9CT9A5աi޺*䑲u>֫FuS(Kr$dVʱϹpιVN^-qCzXU`TKFhkR܇_\ /|rda=EE !OW[gN`y(70}_fW{c6<.Vsey/N!u7[,;)k R.vU!DJC6Vؕ0mǹ90rf91-!xRn8^Huh˳ 7 5`3st4OC77+b /i/QSzRͭe+ k%s`Jۃon]v76[ ul+?}.b}DsAW~:vDthK/qxVv52lm1r[mV~{se6̏H8,n-f ;;>!Rt2=\p3.~&s. 忘Jl[,'N@#:t`ΝZszعu!_QGox>"s0UgrKP?]@ض"N'&5-2]U$h,/;'%EYp,9l 2<}z7D+*|; QqU+:= TN4Y>E:(QwBqKQm=N-AЗ`Xf[xV]OkkX=^(fM ا {V5^6ma j. `hzK hm4wH!s.op(!(i8I[ >?,FzVjֶ`ȵ5uvnjjO7`Qy?K~|yn}Ck:ޖÛum)nٟ[mlIַZ> * @0E#aDV.#,LOno" pg)Xi[>K1+MK3X"΅hAHAt!mL`{5[JGKUz5T~gBU:|fnN[k+ ŠŰ2XY] ^;$]=~ U5L2F oT&p2~q+<²ѥpk TZT T^bVفV;="INj0sVk2uS`]:Π֢fMxZ`= EUAo2) fzBX#wRg^;U5?ݜ#;ϝZWL- R);p۾k41_|8HtNmϔ8 ɾ9zTz XNuTp+"9~gvp1O n}ދ.E}çol0p8v(ɒ*3-t/i"`Mb.n!eQnF'5-ޞ ɭ-#xasntnʷ4&2(TP򥸬ٯܡw"@z®֨*ںq]XƳp-}r|6]>ZCЌtRv #_q.#sjU urHPy:Œ9}2uuk<]hco][@Ag/j< :=̩<6u}^fԜ –:8c2N7*R¥8N+l[ -*1lfR~V`1#MPC0-b-Xq*md)6s;Oew?6ދrRVqV>F}ؑ"2Q+gH5aeg'O8ĄІMҸ(EUu*UL]5Z%.< ଛ*M0Bch'édud3^F;8ƣ+'q^hC}3Up`:3aRpΰqSjbʰlYHMC%G5 +*0/\ Wyhr)ҺEMnN%v)c8y{U oYEΠ2 71koM1i#֌f!ꮮF0:vLmߥogyuegKmؼo]q ؚr]^Tge3&\͹67s *۔3sVfTzZ15\t^Y2. IxʭL,ڬs*R,0:h9fG4 !A÷mLr=f^bvz<{ GU]Gąkq;(u)`L<974zh,eْp{j40ͫU[][۪ï/N|Y^9sԏYaabcS)$In7q"xn=Á+)>0w=#޻1qΣ l?ͧA1ãlgI~%SnQc?p9}4Yc\:fSiUKp V/R#Kŏ@ IefUd JϤxxM .O/~v^.ןu_:_T %}@"Ha{(QOa)HgU"87o=︀0>ˁrhHeDFBB!8dRq?`, 8$ *ĚGOxuEݑmflU9+Q8YFg5r+.kXe2KDrM0e'^FK2/ѩT_C&_Dk H3k>|gŗԹjvE{,K\~BJܴ.x'Kw 5@\߱=ǯ^{>Ck>c27ʪ(=` {0+gVUWhJ(PCo{,mgw%Bh"?FX$Ug[3|w°j5kUIi;6p0!#겜n.ruAŽsPh6lڂ3ZxQ:u@\}h:tWQX1#Fuzeօ3ē>J.f$UYglCg`o i?9 nQG RwPtTS3ځ|Ѫ@P;sz@?\?,  0=tie FAȊeahi(S@ $4dC$$,'9)GsoFܭNn˹o6Oڰ{>K(twcǓ._^y(ŏ6+E R%;㊄qK!ţ"ZD y^-*'kv?bla:Z݃qh^4lr!J $MԬ0PIrٕ- FvFt'C\~ \l>awow=j2\F Gy{7X )$F 6ΙѵmNr6{% GB/C^Qn]en&&eқ5+-ҋˋdv=N9}XE¥_nx7j#ݘv= ;d%!j 汒;/Zs]RY;Um,SқS0+RJu2Q)$tsj^"~#_Fh]P9^vӍ5c0&Ư_γ>S ()x[]˲;r:ɗ~*C̫Ή厕]dyy_s)c^Dp4 z|}u׽CW][cTLt2>#*M9!)ߚGH"#;r0H/I&Ƚ\Gǯ/^gʪR[d-W5TY/O9C}0r4מ]`9Kt`=G,PYhrv8lgE$~׏{>ҟsEVɊkBlGeЄ :Jg N"sć~EH gڤdGL+y*DP~ٲ)v._ JH)<$-QeQV{]CFTSD޼8Dv.nvb(xt|?(^-ϟ̐Rmd~>H*:ivӶ"ɶZ k-e-,\H)DbP>ésQ׿ B47u E^:S{ \Cpdhus}jGA@vHaj1":E9BaV wkbȿS2۫^9A]e( 0g f@C lsZT*{CZI`qF=u?VnK+5R,o3^7;yG}ÆECپyާE$8tWG]OgQQ2?JL;NLa-k8ga*R@e M3NM:dUM m%-fS` 1pD < "ueʠ]S&֭dQ}BG)ܔs3/swkytͧ[ yj( `=sV~鼖S|}t; _wJW9U=W2:KSSL}Q#a`4qZm93) >q*eva˃&LY2Xfт|v^![!\\9Lbeu FF@04"㷠>WS,PΘ$tt BW, Xb ܋$SC.%H&~ [y^nP--ҡ@["K@2bB !kd@d+˳3{LG~_Z@0 q#@dȽQiMpvG.wB#c-_8!3v_Y+dto 䔟Cw躏0| W,?|2жiqZTnUwЮm\V̓^St4xtvn_sR)W'`8~|כFsRE2/2(UgEk ܢYg֬,t:X(=*36=yU/u+g@6X-"xpL O`0GH8  +g m &8blE$.Dwc~?Nd?I ]"K̹'I -kP4uhlx.2˚|MIIn%YfB3@6DD@$n,PJd0d /eQH _x ">eT“湟{yI eo5yj >032ٛ@f fe?g!ͳepr!~m#ӠEr arɤ}{K8)2GnsxiQ"luԏ:\z滧ijAך`>%C%!BWȏ iڗYoES`OG.SKzRr:sDܓKǡ Yr;q%򢍔vMo4!l!zmq\n v=Z܉!H*#a, K e&o}cڌ!po{p?@Xll00$G0H ~nwkg>&C,Qhmg ||VPTszҙESoSҝ=pU0"4`{a*BS˨!u5=J0sAF >( XxR"m< L[XUT K'J@p*P  I/BLE R 1N1-P׶v֑6o7lpX8PXxxp͢. c)hQ&'%%&,pܶlH jl>yHP}MYnc;lx۪6|sv(斍֒.`7t:` =;pCHILKN6aJ(rZ1m,7X򠗤;[GSFYWԉ_Ggs3Ī$K ,j]$58~SdYy]q >a!çj\Ȫ&&26p6G)&qL4DGP 9 tqU{#t;W tyB٬)ͱH0SPYDPxd5vcvNbc gqS!o~BdXgΰ*}Ʒļ|ő[|zlRQ0RJz")ԴtdT{c6Lxϟ>|m ϟ.\\AP\ -H"CD-4}H'DisjsN}?_C0=/__ҟ:y_>׵:Y\OEΘ(EA8!T $Oe.²*6WsVjJDWȶ̣5"!|{"ݙK5?r0^>y⋿s/rTrwDzՄ⒇ .uPDyPDz#`0pFP$4&zW'hy:kܙ^M˺vk'n(lߦ7LwuȼTns/AۣM71Fw-E&Kv!B #bY/F,F /Gkhɖ+=Tk@G;zCgAt}{ fUU"7U :_!̼d;cKeeQZ-66kE-EAFF#9f"3I, m /u 4hGIY9#H|̒D\e =7vW>e+~?tg -#gOP%FD3YF(O!LQyǢ-ڿY*?2f.;R$E3 M1[Q%HG$$;$^=TaRIrIqsEy.3:tqp. _fWʫo0 s/Ӷ;?Lה-y}|}mѯy<]\>ctIwJ;MKJ鱺GpoD}d]9r-+]oD,0Kч~\ha 0 kZ75-ӈ6!&7 }3>C4!3C;|a{~m-.boٙ -*"4y߻=sD@|ѥI)+ ʼo~J+ &6ЈjK(Z$[HHt;]o7'9Eus#{1gL1)=o_u3CHi?x=QZ+,!xңz{ jO̓fu؜Dr0O7Vޏx83!,5Uk8(-VO̐`fb.!+v[D{75V]'%\|k deLk'6oKalrd71N&(.Lro|;.e?؟';3s |_)ݸɸ,恦΅i K |Vsܵ9kM|ک&DC24P-AG_}&ԫ% j7#Z2DmuH8}onp[8Á0њo<{=>~RϿhdPotիz)4oG! 0̓D@\tUJ  ЯQyՈ2?ą~nZPRZY06 Sv[/|tޅMjn~'iPYjEEEEE44E(4)qOR-bb,MsOY-,67`TꦔT[BBBA^B BAABNB/l?/lCuPnէ~}`@DFT/vMc\y-M--- \2 Fe_kԳd/}~UuKKv Usj{J;C e-UWD`a۱gggghQh.+{ K<^?E^E U)(k(4F222J4vVOONm}?[@m">n^ PأjVUURUUQ쬬[9o5բn泄S'+﹣i7VM?0;(>Nd$g@ & 7BN_zQ[y=5@8`7rDH'o>8 A?ib$qTc-G)^|}O>ƿM,:7=mǯ^~S/+P3h$z t-6q@6etvcHvXw/\ҘCr4BS|}/9X.gHD ɛߥV+W(&)4p(g,i] mQ ԗ(/ruI< 3o٪MaR. H/o\*~gOohgkU,ۿ6 _Ny@}8_SqY_!*ޜ+\1%FB1:H 39əz::z"Pĩ͘6xg(hOҵ"TԥS&U%'$6y*ȥ @:/j VJOP^kp ! SwNxiթ^e=O_.Wxy~n)흳*߫=@vG9N^ 5;[$''i)dahqE mGH={ҡ=+\M:"%9mufmV; ؈aq 0+ "[MјqqvSV2MnYfiމMƘ{zM0i|M]MOOLP7n„?Z{]PcK36K Hn3iSӺ)%f+oP24Gh[2oWcGiz_P0e-Ze$t= T/݄<}ᮢJ6KF̒PDH"PVˏ;x*a} 3áIŴ˓) SJB`("! 0so{ sz෋|3@w'l6~/Gj?}@Qh+y+X^%hDC??J!((9 ©29ߜdg{Pp?i_uۼiU"osrh(zT)ʫZ򞷙?-N|LJ/zÇg* Iokfxc绬'Cy*ٕK 7} .usd|ྶ}VWي84(lF?"[ ;^2ȷt:EUUәuB_T ;#{vaqEz!/+$I4٢?+Rzw\~O Ti /4vT`7ׂo_+mF>,>$Tb +،}$ѼtDD)Xh I)IId{W mJ Svk_4/vws PFM7|)~AlQu d= ݊D!! Mh(47)J#H8@a a4Η @98x7 52^d~0v֘u=N?Ƣ{Rtc.^[].ߙZz[ik|~'ԞMW3ܼo揮chpH7js&wGU }J|WNJJ&_-Ń]?Ee3NBH52o{ٮШ~ #|ޙ&C* $%(1c'U]EzWx"'% T|rt:-}q6&#G>&E!UQ3-E$5sE?R2*=!X^g75betp1dQl`\-Ᏼw37ԧ#P :J1( ׅ7NڴZW]}J$0UX4~;Ms7=xV#<"7^K ~3$,{{3~x9t[67[DA9W!7Smj/>]%qBǑjWbmxwAӨcb!Ӄ@,v ="viO5[i`˜!վ<a:yP]j7/?mF>ݣl;lK3պxD+@TCU%H\*/WĘ~7 +J3eObzrWdw 0膯 3^2x=dgʝ?Ec9_:M0E ]W}v/lׯ1\aO%C[( G(md'wO24JBH7 Sw$^% fFS;F-x<Ʃ&޷Qo2}~J|֨ 4bǓSVTԚ.KȗHP$  ѤmpomUEwiwAН:tQ3Q@BtI \bNy&) W YG 2$,2`=2'5kW-z8_t}J,%J;Ԯ97h/1lf}<A0~??m4*Ci00A\tVp!+ΑmvXSzO- o,d*T_?t٣bMi P"gC*IޓF@KP.b# 0tJ]Txd.+ODj'$d$R8yJom ԙHpwpg$ !HB8I1Uh0L{2C0~>}S0͂l@^9tQ1,I$ lul{>^,\;7GL; n/s k<2R)xgQN-kQis|=>(+M>kv)9jE>,hs; ` 2>KRH bpH8< jjɫeŬ;ܗTbXoΌ91'RDucВ;쪫R@E F-5J4]fvKED x׎rXDzUWmdW;EO%mdH~`}"e%pVW {.o K򼣰v~[K3/9c.D Uklee9x Tv=/;8Y ~"|ھ8FKL19jb0!?3@ 6C,s4\CIfh%(νH4Q+ߵ$ r ƭmD[S)8@ FuVer'B\+zUTrhPj_NDYb*mWҡgK8 YCAY^DЫ&ϏpVBt.qP3@N4=P%I #o&kfa Oh#B)jNMVIt[iK;:݁?&ݡfe3Mdff2t FD,h߉USMtz6u|X'2-; Z!mII9vG"J׬(A-3z8]S@Xbeɍie0lr 0BgML!p"/!?)% U5? Fo|ũE =p=g.{k + |p{|ʣc6dr)H5lwi`U xuYQp `!`q4gq-Idλ%s8ky&u5Ļc0uvP o8 2 AUځVАIN71=_ =&LƹäHugx~E: @] @!*T5NJky$O}D5WvUr76pG$ Zy %/)#?)Ia2jҧ % oX$y_/fCCAe! xOs^CwVHBjUח&S}> c~(}^ij` $I!Id$m[/Ip51#fɻ t P90T -ֺkRy;nlg#c`54E!8)'|}ӽ[eb" .BzƜ8HwìQ{9C^.dP,rܯXBh `=%7E/G޼cąyz]{8o#D J7OUFVBo\Ǖ2*.qԄ@$Ҋw4IS縪ҍq:3|!΁:'dJ 5DMOI̼$&]=yYa7,-uE=H7+h}Ӧ~ُe[a6i(!M".|dm*RZ)qQUW/fEC6Sv_5UݲdXΈH"ߎDw?aQ9Qۻ(z'dWLU:'z&""QpP~Z!OZr.UȆQ@[n ;2mϥ;?j5& ۝s$|XG]u9*fk2Z E "DD#UM6Ztq` )Lz}oeREca̎$E(=zTy53۫~#?_q|c01璓hH~YC})Hڔ4qoaCU4"WBȔB]9I$2:1 XM'KOIMY?7ϟR3Xl8E''M>e,Oe@گIB rHȥR "d o]7. JR&,U[$1((ntAw'M 2fT7`#f}޿lwjEgj? h{]_c4Rj%N1@7CjFrT!i G+' Lpvވ$zG/Y6!1i_\lH#/*d>_ 9@ cy8,lzW<:L#oY4a1\3Z'u)N0=шC&&Ҳ0z E>>: -qRoti>t!eRxvr nK]xDjv&eK|9Me4Qoç.Vn-1 !$S+U@ l"bdya{Q=Bh\"b`$L#{5\U ^6*YK,9rذOq>Ż[B*2BW9u[Av# Rdn"N)(^Ȫ+X5*; R(`8b.o!2!Z= fWFVɫVRV4( =Ҋ9? O+ګeV^ݾʒ2!1?:⸃&IWvCy,"ݑPEh];R~*/x͢$DZ󱒈\xLOyy d!I&PseG]WB!UM3^ǟt:VԻyQ9jթ'9jlG'Bx7SNKz #" czPyL: ,4MC/R.9M~LŸ =#@} 3 .xi;vUEu@]l@~ &ѣ }(^$cL@=8C›߇'ȭ9側BD?T~MԼw3d5Ը|?.{V'u-S}cobj}FpM pl`TFtH:^63"7b}>$ |i fI[[i\7n/_D(L?AUE|u ~@OuRN{MMԅ\/2NnBѮ٧hrWVTOֽ[b_7zl(p,7x}mXmE~)jg~+|)I2ō#AF&dWdy)owcUs~4xIY+JŢyE 4pIok1Aڒ7vD S y.AZΗu}ST=rX4ʧ {ۺ]}Q /eiAQ&MJ-IUi Zw-!AT! rT@-Xe0FvI?7Բ^>^GaU6EqxYYYco:hLvkX<YrEGUHii<8 *؄[~bDo oL_č~1K2|e< /9]}Q"cH5&;yr=-l6pg gaVx8*0珣 (\2g# 'd[=55E& m?p&Lg[{S~83w3l<'>Hj{]<{%nQ$7[CS~8}pVթWmBKCUXZ%hXMZ k3*Sv?3[CLW({axp~:zVpT MjSz-S[I\ɔɜ:JN˯K =J~\ٟpvU{,5.u$F'=15*)'h|ςkM^,ccɖj͝ 6{rB=x0P!Hx'{/ݓŭ$drq ˂m3Xr:;KO=wŤ3IRZS>G-qerFjDWoeE+g@B" Hp D!l BMC2q_WFSn|`+ 97<~uS){JJerDiq|˅?qxOdۧ%fkʃ{VSeWEV-&sM"֯#L?!F?oQEn<~]of3z#2w攋 !=rWA׻#}V^d[ݤeP*D8{>+פkLN0SNaOKzlr o{܉+l6s i(6ߒZ$^gU$\eBAQ.c_7ӷk]_F>~ϥש?wFY1MLRY|ݘ3$G;/=`H ~ȅ$X Q+%4.N1 d)Z1dB) 0OA:f7;:},,ƕ+swŽn°h% vED8u b2Ԥǟ.Yy)UBJqٮKp{]S˲"DAPA!n0RN"ӗۛTŊ:x٦'$&r/X 4,ݺ K6}n6 R?b٤}M̦ѧKLs]i9NҊ vHxG`?oc~ gr2}C |B2>8Rʀb\l1/{YA9e';֊@Z  Ƌ:Q$STe{x%tf-'F.sD=m4$1Kz^NFYHDW2{ft %5 耏sf1"[8a 5t +~ E!Mdz)!pTՋSe:_GSU9d/ H>GQo"_p+?;Lm9i oj3_91\SZ_L#OuezSP?x(Fߊqb Vd*2' , J-z`)5Xo=Cc \wg֦s<ΞvB`־"?rUa?scH;$,e6Xã`o7ocH.HTtE Ow#: v2fs)I!W'CHb@9 rFx&s XjٚTARŸyKt].`Y,GI1_rjWB合&@ 4H̱Bu/Wצѧ>cק]`I05 VpӎY$yؑ'/ozKpj4.5Wg}|CCeW^)mym|@0G=C=z#"֝7}&;6D gwX|r*0.q݊܊UKN@G xD'\sa`T)eոڽ>[O;~2kur^v l~xqɓEZ울{^OUغbĚ4|Ӿ FiKbt@ }A!Q)D\ۊV+Q]6\#]y %وq?B rd}v Vv2^/DiEsB9tbΔE61|6SܟKNqc9nwl`h8ʥYWP 'IdJ;xt{cRԣ^~^f3I{_#s~C+5n9ݢ? (_5TgfِEccz2IO,xr:~l74y_&3,ϗ`$jB:a#3ȴ>`%[o1az9N_Zo_7>`~Q*:z=J6}-XٖF/{Z*B她<좂/;Y>lc:~ÕJ0W%0y=MVXHi͠x c^nǏ-2j-6%v+!4`Ծn<:Ž-!_3\R3~a}J~<펖e&rX[fiO 蹋VU&I-)mSm:\1%.J?j<(WG6d}Ba0cN}3>Jp:H^sgԥk=98(?.<∁J"8ۇΎO)#usQ& ??>շ37} gook-jb2#/}Tc#.&2m䗔vbpW4t` J%/ JZK&$} {{Dx_GI/KFPKꉝs0o_}XMʖJ}mMSHgYx;Cp<, eʧ۸\cFI紜/)v2tU?)+'8]MɌ0HP" D݂Q |B%]odGڳy;ܽ).7U0*%VdWJMRu[?⫓9ng2 [Pt),$oQNѸhv,{_d5{m~̦a"2M*z{v8SH~+5pw}w6:럣~KmtBPQ9zՖp͖4?;疻޻)/a5lnۑ #v:muӅĔRۿ~ϣo<|w05φBq+ɲ-7A_r(bg+Ki_]+sX\Osh5xotzS $ k`mWϡXhy%dlj~KMiSgx<&ruMKm3cȻ[֞ܳOԢr/^kAM[9UEhMgH8 D25ik58ehkp*~yIo2 SÔrG>N[_o:N+`ǏdG*Lk(Fϝ>UYUUYvꭱ3HjP8$gՅadCsOn8^RP<KX (#Ko=f1 -o}sc{ 輟yr ',z򔹀 *U WtxE"N-aUsB~q8Oz`()zUC 2M+bKjK7'o40jZTr`tJ!4ָLQ*<,h;CTx(Y1KbX?\K 'dT^̠!f}|HIG? OFʻ]%m+AR~_X JD#Vܫi? ;p@dgI(`ed/{0%:I>_ @`0HB 3 'C:!6ͳor@;]Gy.ڗgSeP3q=k@GgKJkpkS] ۤP@ ( qVTFjJ%%L9CfSpx ]s ..چ}¢ʲW<|LϪ2U_;tYnMo]/K'؎rc'-ߧtlVWTSe]!ܯQ'9"0Pʷ{LDfH:$-z~5JKY|=n7ҳoMUFM̨-]6yye.2,6@#(#Fv8:߻! 3r3)v"C/f iw;67cK*(KVO3pwP`M2di*:cJ;׋LrLbk^wH;Vf8c2sC#QB;Yą;Gtm OΌD00 Ȉ]8ELE!as,tN2(吺o8$2jA`K,`֣qAd-FVBĶ 6P!D[&R0ҤRSB\gMq~WAV0D`-q' nh ,"J$̌F("%,pa f ]Zg2U,5ʑ51GcđLKRB0' !ŀ"+ W A`\E$F,v"ɺ0Ɂ(H"0H%^T -Q! FԨ샋X1$$,OBroy`^QhAR$ǚudԸ58̈́6e,؄!؛{ݝ7+.t'&EXzzj߅ZEi⊢-7yr'3rk֛OJ 81GMJE[hrt=0"7laP=1qXfb"p% ޿n䱔x\{ 0LPkPˇh/H8p 'q8!iO)AOU6BءK&t;݉,2h*9P<Jvg^Tbm9GQJ=Sᒹz|?E*Ey<\se5ٓ$͊i)N%hT\`y!bL]֌DlzFǟ@l$dC]?M"WU(R57bHh~e"XQPqr49 I9 N{-H1GD撼 He\ko0욬uP⪁h}d49]FmP~nJq< /c?J T8p(A##>ƲO{}.C/BOkS4b"RbdQU)` ,Y&8/BԄ i @0)>U?a焦.[M! [\i׀b;qtK7]6ǶJ(NY)үd{RN*Λ,Z6VL=:>f,(ɒF# h .&6G8rN~Շl l.n{<]١0_|=YT(`i2l9 ˠ3^ڢpj3KpεH H]lBX%.`xmi 0"dB n&u~boJiǼBϔ ޿~G(=* R@_T' $ie2D 87eI3ve }_!NߛC_98=j ya&ԣxmBLhZ[,KcvfhZjAH:"9PC0ӎ0DeIPj;ׇ+0O `e|@Q_ƲA{5ݽʹ%V4,=SKiﮚFc͇*t\ 2j5^SE7L0]@+HDIkgh_:f#O?3CۊAA$a:޿b]M4Sv}wlw?1q(3BN '[Kv\?xRCm1$BHv iEt6?V{pK@+oq~%w98 0hJIŨQ-dOU>Kc\WyN~-5]ǤgG}^uYzWlR},7~6As͹9ׂFk{ Bg'i>X(ƙ{n4c=B=ᮼߧmU;fnm.jq^e/zƪFRj&q8 ~m[ߪߠx C4JBHV\dT6A{̈́7p}Ľ--巗~f⻯ɩ%ӡzkdNK'+r_;OMCð?+ BO/4u=]ð?  HBܾ;g'/gݶ > nc p܍J0q(Ee_\[W=UB'7c!< >^{~Vw5| 0@!^8^luLYs@ 6GHŀroR$S5{lh쥻=lvi,>7_3ȹ6dɔSH mZorbcɓ.,6Λs MedOYϗZVYuص|F<~䰋$(Ru,4k=*FaeWh!qy>k#DdO#6(38bhHk4eM˾&H'|Yr@nВIMdY~mab*a_LbVۤ&is0jA=d󾻲)kUTu9 ]}PE}R;&J:I~[?/+x>$& m|G_J |0Q<>T >%\8Exֻz*p^ODWHV#@ers *hGL;ixJag-0;1X04餔io]w9jw޺]1rW/(P)LWxҶt3kpmg>%wj:i UW9/%N]5}׼?7ʪaT1g`x16-kbDn6+]7l}+,|~\ZOҫSbI/9 s]LǕZv?ݎ󢝪INd:yLj hyGd Z)cv}0Z|bmR-ĩ;07X;xӊ]tU]] t8j_>-@2 Rdr~TӔm =(I +Z"12 P8.QE;"nXֺfDHH[|íŸQ9 vv!/V;Slc 3^,X^%):ؗFĞ|vnAYJV|1js#i~,lEo+K垵iPCRtIS#xɂ;+-cVCr *1E񽰋=?֏z?RtװƊ=3aiL?𛓦{w\̈P*Ա q/p^@ +!HBR(D tp)IKpo(!Y`nb'SkM#y"p<|c̮Qr<#ѭj; ;FqG̴P)'~j6w)۹DtĤǬVIM4O P̑MU%$2_WLJeɛFLOVLu Z[f"{ksO- X#FDDcwFEOП?ȠN#F{ypVD耰^C@!dٷf5-/ B=,}fV:k###i0ˎk!*[[!m18q U%+Nvb=zO{}` e!XCVO ))8Y j{={RXVO@#219[ii u/"[>\LϜx\. ^˱?/~wqst8;p? +a`HJ T3A!!b^GϯVKrс7O}kMΊ;}q`aBppؽc-)ٲmƧ+|Dx!"Au(unj jO8nS.:"@+7 @mk?8)b(0RG(dұ#c #FQ&lB=h=nЛwN3x{:[f LÕԠAd`RSw\'$#:?N!T\9RWξ[ 113 +i%0I8 eC7x}ʀr@hf*aa0! !Qgο_r94֭RQUdRۚP.Srkp)g=F3nŻף D3J,]чyͽǻ_1_NXH^ Jv/La<#!$e\+_L/X0 H44Ab> z~[1?$mҬ"uӖmR;STNՙIdeZ&Kw$ m7uQqvb-7ދ]QsrVՎ͢k<**v[ & JD5`]/ $rMYD{;kJMy6瓝͔3=~**Mb?/G*~;Jtj ĩL7YDG0{جnmN `H*|Fph\PUkڻ* 'bt~-ۼ, F<m@)fi ֬CldXxXhXlbq3kr 0evNK Qw?s緞y~KkgEEo!X/nӪZ.6GɾWˎ~=~^`Pd6Kڂ1q@!t&Lw&FMƿi~Kff(=c5v;# y21wΟl_`͇&4:no*xzH-k!-Gzz엵 qsۓc7UK(A#J͒՟m>FI=88wY{FO4!iO$eښ{9ր,هv9 jSWtcs'e-SPJXJJDJyG,LgFGO#K|B5+𶬨+/#*+3pjǷ/xj|@;HD,` ~,McoOO꒦ ;8 e <+0YC8Jp 0ْ>"M `cAA+0CC?ze._lqߊ̱]77۶Jv]ŴwCijvii5;U~rT&[;:Fffϙ5 % g#]S ]JN7haggg?Igh0UЖ9%%Y.4KnkK3;/]Z|>؃% #Ͼ@! +0FH3 [a^Gw[qmKh6UBhXPNЅ^X^;o` To[u<|/+<; QR}n]cW9bѶTu~ڄ/D+6,}w*7*<}=sgbfҟS>&UMLKe^,W7{ڊjjaSASG8S$552M`˘ݮCARA` B JPE~^nxomovp SEOЯʷ.i\&>?:ono8s* NTyqwF]jhKK& / Pm\gTzm E7t:{6tfn{@է?/M& -8[ =nX>㓰^d>-C%> y4\*0SBABB r4 JCGWAiG,]Dnók7%г^ EF2i ԤD]_KwO>L-]";:v7HXx4ё~)0|paoI;c[KۢK?jƹ7-/^D~Wt;dSlL(#Lby )2_8rDQ8JvrbpT DdےWT˯<%֓I%*DLkRO`ۯ#kK)5hyN*)))`T_`*ɾMXrwӟH0)w3@rI%`DYR MOypSsC#Ba/%j*Z $MDϥSutݶD1!@@A@%"_UyNGOuFL91]^E!p'B:~Č| ]ٔժ֫kRx2!"g% ) ))(jg("bh"|/m팬\ IXO,˷1W{)!a]_ˍZnYEA-3Jȫ+H"m$0`OK˅v{Ș_ x p yfffdd#SU'#g# E'ټf !ŭyna]=7a#yL `=m$0!///i333233!310//LL_LPffA #K1%% "I ,5  43Q9ߧǏӏOg;7?*>/m7;k֧TkåK_ZD+&`d@(P .>Krrr''&rra i99I@ -K%US+rpXQ8g[' W7^$hh(Ǐht?3&bbODD*tgYU(UgTD#dv ib~ț 8@J 2!! ! f@660rt #aaXq|{~Vԇ\뼲u01HȹvPrTΎ>jz=wEf)zMyz9z"_Jл,ԃ/ML϶0J+ O:i婟 R^[փ2l&p&M[ͅM̈́$ZMtצABf+c̅MkuJߖ\F)*1@b;>(;&rʴ[@b긏o>/=Y7 >Jm T! ! a %$n:+WV{1ITYޝq'=DrrV=N{̡uަ'^t 7BsofʉuY߭o8/RE^~CR垅^qcT z5r܇w ߺ͛9`9E6t{C(EQ!$k~8bߓ%nO3ɹ?XSRMxx]!5:W$6U~_`/\Wd˓&X%M[EBot'^ We:m+}&ͱ}d788SU16v'b=[ nb[kE1.Y'iUs qª] m"KѰLZJÕÑP`*r@D\c[ɚH!friX2Dhem5#8 U?cG6ƒ\b&gnӇW$#4`|s]kƣ\z-*t3iJ!-Yj`?fj`'GB$ d4(eѮy|8"D`~|Lf㺾0ǫϒO<$C 5/E4hҢjjh1"շoi֥Hjv_t D`QqkDnGGD_|0"7# M*rÊ<+Ձ\[?J|[~uT 48ёĎ:W3"F|$6l*PEG]N&ut; F߇<oնTXӯ!xdw${?&6DBK~ ?k_$`ϟ_hg}jr2FeZIA>ư3DSA(FbZڲZfr=58fٲ1V21" F{_]i\f}O(٩2zcSWH_|1HYlz~Mw54r׵Q`a}E5DQ̮Z@!T0 SsP-!Z ,%*7wxF3?exK}n!ӹz L4,LguCEմ\iRSP ,{?j}yҼ*T}N_ZQYHP E خx~+|k;Kũ(/D5WN&q.OqerO/4iyu[oG|t`\FQ<o& 8?w}]+/Z%D wNR@ ^L`i ʧWo孧042{@|۾sj퐶gw wtQ3F>çW?L 0Vkq 0bDt"'qڨ)5>KJin ?T*?1~n9/œ'oeu̹|gɉWly]n1Ϛ,UF!$Pb!$B\P)CT..1 1a~NA M~ӕ; jE{i-ʻmOy"{U^z}Gp @\7mDas#xn{D{]*$oJ8џ>‰0F-Ljٷ6?U"rHM|?APT4(/8o OˎE&wΜpKvbCU-j.+`[*ETQk*kAD3ghq%+=8/=)U&`ȷndfj=5Vu41ӿF$,rXyo@\!MCcA\0&6R˧yþ 6eH2SB1bq Jji0;x*3t`u͸vMg&-#VT2Mip(q)EhHŀ) _}9#-EjNͷ7Uo*)8HE ~QCC6ʅҖoßD@lxd$"!t QK`&rik[ 61 3ۘj?M:96QׁyI;sm%"vD0Oi (Gd7AKîMJl j$A.ǁ̍Nq#=ٛ?KJ?1V1Dۢ2JSTyD;娡!eAhXgM(&AڢPRg JlfZrPn1ը[1aе|S&XLnTl[",R\․Em.%jЄiSUzkq8V96t%{Ink*KL&^6&cZZuc P"˂ Jhb/"w.&, '),6gQ{̧EYDUAfDr" i4 \D)78h4\( "PS+,L9TӂpS " Iؒdx|d1E 81$VIfdk|^`{h\j_|o$G=܇njMYσߵ$LJ?WZa ;"24_xpnڟ ]\Ho;To(Ƨ>@]5w'K;d[MZ%'O\msB%ԓ<!a=Q:ѯнӼC 0 0 4j7*aw.Z}`h,ԉG:}b\(<^:ںn~UwA}7. ~sg4G`ztFH}_b|@%11*30;w,g!?IW&?:F^nvb0B !%8l[`հĸ._"e[o뵲 *ޝש?NN%-Aںk??ۆb?d]kk^ abI]Nۼ|UU~ Z]BE#4JcI5DCG/E-Mt=z|ެbvy<#~bj^*O؊χY]e]su36V֜I?me]iqʾκ{B彐?wM0^'q&gbq<>Q?^n2n:d8&vc Ey`$I"Ш|Ehhq GR{l2*FIR?Y?ZߡY$hDgޔtJ!~C-JRs&KL?ǎi _< P7&͌լ( bC1A7pRl$D Lrk\~7[Ɗ^ ꜒9Ia'+>'\L k8򿛨?YV:baS.> y @2.yTON4:  uet8l06QE/,qqo:>!-pV"^hϊFtF/~w/8 +ƵsGv\4@{oyql!oQB~֣9 sF4!#];":N&gKW<| 7@>|Fް2gh@৐LwRWJ,rL6n2V$bx0%)h0 8 Zwk.K!lh(EX*,Y)(|+(e˜=gb͆oP1#}`-5Db`.A錢!vstu:gOjTY)0 T[mՂ{w4^p]m_u "n,˄'纓|ED8{8 dCĨ̢lyplX]$2d4ȋdTI&\I2 \"$&SsA  2&ؠL}}pPāmw5tKz3r0}{ű7zc,Jђƒ\qIvL:}[VuCݬEFB$Gh:Yi쟷̾z{_Avos.c߱a%ȕ]U~ +aqLvXS6ryoLn^Z…YԮe/w믱rk%ƟPb~^t`m+nAA@ !DH@T\_6~_pGt>褝-4O%yIw=`},C +`czґێ\Z@f 0UesLקbl:\ JBkp[q!{4UC\Yw ` 6S5~\ul٪bw} f$H DR*;E#jG-kIAi.eB@453\^EќDBRypQZ>nGɺZٶ㗾 m/$0)HVGp.?hJTJiH(XY qS'~C 10XN kbozk:O]~FO4b$' \+8!qaAAȈ+DE29bI$W!8D1VPe")"q; LiDЕ^cݹ'fyGJ]m޹#?x^z :i4RZFp;DžͲn;3|fXv`(Z^vov-\5jE8H}&8O%7!/̺j/@&z0}+X+ߗ\"zmy2f& >FEVNmvOK[nyw΋n=F X vA(Mj /Lljyopoo$_׍ƹɪEFjfdc*䘆[c9\ffv6f^[59DuEĕBT9F4z ml C5Gȴ^VJ gX eoyڧmxo߅:&T0Ys*I˻Уe$9#[t+,y%->iܞ$d@^DCnǾ=2o۴EӬOSﲿ˼q8 !joqux(DxC( &&e=ųq33$½M9r&?ׅ-߭7BR0`=m?sil6Sy1M^*2 1Ҳk\:g'ǵ385S(+,TMl2`mҩ˓&YA@.;7۶`q=.˴]SdTTp.2Pp()0@8q@lj,$:}CFY%R$yW;pI/o~Z»yX zV&6kP%} >OBǼw ?VU*U02Jμ b8#[ Pw{^h(4T K򺤺PJD'' <>Qsk"E`( wfB@sAH t-9 Vya 3,(HHcNbc7`#}(m!rx#z'1̠o508Nk>ζBZ Si4NC66J#-!ȡ16YÐ@̊*c:$5෧uXCW'!1:8hRxZo>ɌبGi*?ImMZ4 ' 0)$Yw$&FMŝ5֫>pqg'/kNyO'^,Zb@>wn/;K`-?FTG1LmnZdA- (|AE$* 2##,Waa%ɟ$0nѓ<-8 ?w^@5zRЧ};J0H$v!>(2Iu z TQeO!t}i4]s@J4lK;>gl]~,F%'[ΗF:\_m7m!1=!!)3_NPPPQPQms0VjkrMEwOϺʘ\|<Δ\apwKȞTUJV欒\==H~݊?#qFGa]8Y&pFu_a0$Cb٥fN,5}o?{dD(3&H TH0G p)@d3tq}K*E (& d $HVuȻ˞2_t6ٛFӹTx)٤'M킅—CM[~|Lo}luDq4jD 6|bScZR`eb,}/`J ΐ ׈'kPRċ4x~ N^K0[EmUnr(FDM^8h ِPY ̒ܛQ>i%0ZHF8x'P|Zo %B}#~W8tԺ{z˕6eh:|\w|Lw-h<0`0o%>ͼQW[Bţ-i|zScEO4q#Gű)RmVВ;^ĴLO\-A$S5Qi{/n:v{^z (w5]WTpCU5tr1w<ո/,mHoʆP`,yS˾NFpzbVZLQ(s8|5?3 0+|OHT?>q!CCcxg.Hr2$R)9abS&qcKCYAjxL2 b8 (DI r#"8 iBJd#Gq!cqu#85ҵ0(?)T>:3||(#wݧ?f1i)bI`|L]9#?)碧:q'74զao6 ݲJZ9Avnŧۗ)$[{W?#*wWK,3WU3J.v ; 2-w {,e%}]G&u( ?ӻFi6Su#RaIk?į[tJ9Ed@ kQdc1FS |7 |Mg=69!{9w~9 8ĤBM_\M+ ܿwq{/~_]{HA0S=_e?͏re+rK$2Ee1YJkSCZA+ "= %ʹ߁C忋Fx24Q >/3غ1u"wH~)f87{  3^9 Ϩ]y!qB +q#2Fࣺ׶%`wb 7e0`?a{~ ߃u>`T`F^dCӽX0f?v0!H Abk=c8@ԛ1X(u8Fk1fˠ o-cNSnt[uZgp &~!}U,o`hGCjΝܺNJStfRi&.j,jvsT)ŋK!`Yd-pÛ^صWn[6NtILھ08{}f W%ExnmI<{ Mo⃱<R)ar$"ޡn{BP?ϞQUtpЏ1JLXwh?(y'=ggv}MW r<_.5]$>l]P/8rc^7x|lL'5S^$? yiz ZT5TqX* |5OԎƏ)YKԢDS&Q*ݳ.\vדpߗ_˚F4_U|,c #c]b> 1==!v$p x^N?»bx[ݾu5>Wo՗0}#{[)) W*Ώuca0j<.RZc ӊ{C#GQIOQGRSCN;w}{w'=}73iŇx2( j 1&i0u+qBPB!+!NT5뎤dn}r[=3LidN ս6aO=gi !TT}@~u5fqGDO[F>?#bMʱVC{RZ ?㶜JܠCgy:Y6r8͉Ӱ_2yذ֛?7G%/G*_ $U <Y2&Wj: /zowgWsamKdndBh( B9Z=)3Bq1qJ(`\<@  t!"dNzUy4> :]K7\ ,@QT, QբVl#.0==TñFw+lD\"S RF\P-2&?o=r,ތnhw0,p6*(mDK5O~uڋwΓ1{KcčcVc)G d ,D # QL IL 6, HM{ I=H@&)ۓx58x `S)?M ҢSD4%贝)?ݧou|Ft-3}~E- vߛ7lt$2:+1VHq2p ɤ"$B$hywI^Dܙ>`Xۚ=RWRH{b(!o?m(Y"RSݤ D0 LY ^׭:vÙ^xVO,#.wf:G9!<=*梃SӲP BBɡ2dA}g=2TF~+&abi!"\sqZ{ij8fAh.]Ptz|c7ocprIIK<->a|u2R@aGzY@+*% ?Cg32 +oJY N6{')X(g] Ϧ>˗=Rdx]M֊Y~X8Qe| ӕ/vJ[h7 .;&Eq;H]=oa)lnVsL۽)}'?5^gcX.Y88a}W=#B>cPWt&4@5\ٴah" mMoIh4.k^s׃3)vGWTbh7a*Wٮ&Kz$+^/7l˩-sVG x9Ϲ\nRMM/FM><5 Bcp!6*&334q[u u8Í81c2Ց>* \`/ FDxn݄Mh}:Hf0tó)珢'S!4 pڟ~{)0&qG67X77YtcI;Oc({J1r@>Q%`e>Ã4nԲZ{3woa_A 3RL\(+uHNԿ5&ķ`Ȳh䣅1`Y^ 啣q)Š$ޜƘ=Yj'_J #:I헋w"H3J W<M@rI tӃ#IC̐7$\-6HZ>=mY w#jz՛i 8l+.,rDl M"(_MH xy Mj o2NΉm1l p5+r]n4pcVG}Y1-;Eܘ%0 r@[ Ƃ$鿯C.;5"wZ47%&Rt n^l @hںJ]Jj\H\ChqX. `ahmvu^~ *ҤD_ƼQ]Bz^|sԔSD.v &?_9ҋ  XϲBOcE|ītq:nҫB d@ ! t cv'3)@,53'\VsfvNDGPJ%q*CEА֌1%--m žH1ommI @=0)!`{ͽp~k/I+ʭ(qEm I\k _ØXw<8VSI/0R;$:!QFmcGOCn o3!l*;Sh4a!'.N~+F;!Jf{mxnrMӼVSm<.IL&I`]uDdSa;ï&q47LuZ~p x|ssCvcY6MF/ڶM(MF{?`#Ԉaj 'QG?2cnӍ9K.8Z>Q~]؝$u 3q bsĚ/>¾Ck?F[%H#b$9L#0dpMOFheTE"znK ?~JD7)'SŔ\B-'[~Zej:YB'ݷN7Qj\;A/0oX;Oc?(m (XW]=|JK)˦B׭<3UqT=mh56&*t YxËݍvUv643žx&MAt`6M&Z#Kq?ƯnlIXLJ&cGɖj4e F.pE0nYsh.-9 Oݐ@.x@fx u}!\w(bHAydטH^S&`0AֲT1Z?ߗ+~s-\EhwH,N/{[]{ųo}G],;Wo_p=~?ug}}l +xG [:',-4vWt_K\Qa.ڳ okJEf(W;ZqBQוZ/EN{(S/O?K21u\:ed#y6S0+= &NA0rx-ʍБklbm}V(g/c>b_t%{;"5C,ڵr'I~Ѭers䞙a/;5J޹|:xUcwLv"> ՜5oϕ?pÃ$+;)Y"ߨz:nF/]q]Sk\VGE짱&Vȿ ް?,h4,$ihǁnũ&БB ?ΥgVOGNm_EH3x ?vlC4n3Ӏ2ĞueJîL0"zݝYvgF3S'[%)kMLlM<=^W<i82N_ű$7{_RH~. H^#VC|a6AVQ_8e((>`x}+SC`(~m* e'Tac G!o,,kV c`j ^j9&y; DgbRozhJ.-U$x âޠ襞bDl_ž&wvz&jvU3PH$isu|ߥ6rM2 )}L Mesfuee3Jk2 &(1`Zs)OD0 zvS.4N$)r. iP]rrҹ!\8vP]BBvo`B]4C]yuFǗ|V/w|kR/պt._]IU_ AF;犦/ !g!-4Hkwk3>fON,~Yw~M歋f/ gO|5u3 W=IZ9JيnmYʾ±PD@!@3{@^qy`$53SylLM͢7bLY(>S9gZPƆɂJwٚ>mANKLP0ҁ/Q8[ߨj62,J(D DcY8?.M#\W_S>N)ܟ&vSț5o.{A'*Mʫt()sj/޶fAyXfk|/;ULOj=2Yҹ}w_:EqO[#9,;zD\5v,o*+]TXb8lUtP}U4D,r17T 'FV?gƆ_=Aބr,.9ByX$&pRȀ{@]|✌ŸZQn[ssZ{rv}W}fMcIY0V%R<^+J{̬Ț5EuMH 6UV`\e"{1 }?|_6FyƉX[Mb[ ɕ&zI)դ<"?<=$]έV %oWF^EFA 2@#No\ɜ# }`GglD?3-]vU&c^9&$&qw{LHKPzEB\w YY_$+px$#*4g_rnF)lVA8A4zMZPiurwl+.Je!Hv5,w[;%.ݳ>o|#3R2 +Tw|X0'I[ĎAhf̡@ _Kw@$j%vL ^͐%4'Kiw~r8p5)Ξ()N79zPsUM߂6ZQN/5Ԩ2$.|tޗ?QBǥ4XA9#YO<>I( @ԩ* q"zmTxf%9QDh qٖGWS*\ +~Zɦ^?ɡHi+6HMRņ<8`q:8fſ5/N"9R*]u>,%C()P*1aZ4"< Lb N}ꔰߴ-M {J[ǎ%S yZDلyG&mnu!F|^'7Ml>P~N}ksknwC?jgzS3SYzW a}Kyhz1._#z<ߏ߭>&xOx7-6ssw7{}7?vg~~/?~!>md.o2]&x+M8Mpd/g}hyyf=@0p U-UgpaU{4暑p$K5k =&H&R]uS 綗 Yw?5HO0h)sWW͈”JƽEPQ & }3Lx^>7z XR8c5B$Tm\K-,+&.G6#bcl%v;6- ;\v8 T8'*bacj9UrRD×uNشKfw[ ( }JEH^pZ^tBɐ!eBE6I/I-%$*Ky ],;зl~-k,`M9x 俣o<+뜰=z@QU5JCQpiKّ|qMQ+a˴ͭȖ0N@yg# bON:?֋dH+"b6'DHH @(Lʾ ߟ%% =Ѽ|` Ũ 0+N $ݍh4":mʩIOOU.t)$KBTQoè FeP[XChFpnƈՇjܦK7]Vcztk:ܺfψQY]M&A܈jl$yyz}vvοYΜ# ,-Vܲ"ӬR Bu L^}]Bj"t+PcJbYNaQ-eik;~ g7YNcwܗ\ Mm%\("kxEZsV|*Y6=ԓc4dw?qߤUbr > dWE7h%{vT\-rێJ65g37+c;w}G (5/,z>X]jv?iP!Y^&r%xi72g#͸ɠɳOZlQ.:V{eFGYp0m{tsWy7Φgu(Ǟ3 /FY0!ܿ^gtkho}|ɳϼok2IoMP35|fh~w>\&y-GU-oeV|߷95zMb]%9=-?bMfòrl{n91ҜabQatm}>/)T΀5uRțpۯ19p)-.}{=Y?e WblK7=C7S}5{*wE^md%Vz6|Β{SSs/S~+ń|*6/S=gY?>K̳wcɛ"KEy{Q'O~?$m_"XoMз:_< ՠ6@èlj3lvTeb2{Ⴅ8MAyAWB&HSBKyWM.>gI݌mfvUaVYmh11{Ӳ5ը9~xTtcL}y/;ס5kKL'X5O?Y:&Iͦl 5;m[[\Wc]U/{6([_Խ0t=SSFZnm 1!s?L%.&\qd.e^x"e}a殆1lwj{'>s[uTm IVxxHʔNZB\TpPsv86g?˨pR Zf\i1WE[FиUn(pL: YmN縅سfF9?%\ :Խ'Ě!iזg-mzG An@b`l+[ХD(nhԁ/TAhzw5TUymgq?6/ْҎ"$KMLOV ]{m9ߋ"~ O6}|6G x`-]U#EAodmI@>Z[?Nή&4X>dV̓#Wn`)ʡ.IEyAbzV}O;*Iw):Wf?}&#I dmk|&ֵɳl[5{2nID,Sk]䛄% ;6VWRH|2t 4REZ؇$5! +#U kj-VS8Sюo(H]rj:Vw> $z-ndd5{x젿2n2a"V=/ϺO6d\#z_bx] hF1u2qy dȟ 4jZSğYd} kغiDަM'I+&Te?z<ϑ_Qb)Լ -TnW!?NMj~w}ee+ l8s=+zv0k~?W6擝cs):*!-œ6Ο(r] Fk n`ovDM O\\Qwoj2y67IΑjqagtv)Ē+A0R/5">mctEXh·ܹ[Z#nAԃyRoPԍ_ꂆo|e1e7x|dO#-?dsz4! 3(Zׁ#ԔȭL wV qZ_tnSZ]a* %$ꟕz0؟5nr࠷xZ(R$?baq~Q)D()@v Dld+jt W dD30+}Q6bƘu#Thͬg?OPF:*n "dAqfs"pgNr)uH;lm+믍x$+ b, PHE?Zۛʹ,} mFxgbqqT!bB0[s0rÒ 5G3A:H%Y|c >Y MlAt4BAHA s^ W8t\~;)\]텣Ps`=~0bE;YfD =̈́C`;ܿ|cYďi?]n w{Q^nmZQ#m[!3A Ė@A(4X@~,DγM@DZ[.5΅ +nHAO30"(6uo[LADI7Ar*e_eK28:o-"a1i 2UpNGͱeБO@pX 졳eyh0](אr,8P}> R[!]or?# MĪzc=Y<x}xM׊=E$HD)`H ^[Ӷ,/f_ҍKgW!ؔOy\_g>A^*ۮTÄt e??5`&:c gZx*4 ~&LraĒʤs8!P s*Ԏ6.A;99wܧYs8@ӱTMq3l]>qRQ 1qمp| SaX (@P>jTdQkK|PXn<sL(Ȑb5\ߵa|{t` bV0鮳BǬF2ݡ+Fir$9gw@s(QQƯH:{FWTX E6dbe&(  ^(C'tޫ;d4)}@,x4's~ NJ>$1ь>  y{ 닅WkĚhOAh $t1iN&9F3OW]0`_}T`p.sۈ/n%[`v"^io@E%NBLp;$ڞYYu띮os|2V'F/-{tȍd&ĨTͯ^ЍF9Txh0xO7퐧\&O;%3Hͤ$v0;J?dH؍:yTf"[pE C9.vS$~<GmoT0!AĬ Gcb1KS(kYiitj^t$=>kneVէy,XvyXhh`H

ZJb@]":jlQ)( ".Oo{gBRώFbd-C 8*@KDr 1^JIʅ[hYs+Bfʚ--: 9+@f+J阐cY7F]k&zt9G@lHz^Յccp -wIуQǹ7m7N412 Ձ\[I& +1[v(@%;3 tF< w1lA$rb %LبM3 R0gZwXѥm8ObjFdwQj@L\V"e B̧T۸BLr8]SX@lQiqo iȸ,yS@ AD:-H% $Ix<+H#ɶwLTbQљ"=-B:fb BdUM.9%P@g(e̝H 1C=Z`H=2/28wB/I\ :'4f'Chaf" )H @˓mh'~W$caR&F 8IwDnΑ6G%RQz@@' @;5HD,N=>qP/xqR7KZN+v&HG3D hdv7\{Bc=|zroZ'| ccA$~ucL  [y>I n)Ģ`YdIE>vMF.Pk׷Tm7U>#brB$#ö[N?CTdJ83e/:ZeJo3#2%~ufx'%lڧɶF+`+fZ,8CWTf?qb~;Xg@c}< @g sQTY4v_ J *VeCKg@bfęIg`hmMl1!N8)X@)\á=l^4SuKՖ?h6j]${bwwF=WB& D+^Y֥1@aV( f\OC90s\"bo/q4R @$uQՁ D6X@d>8!ǫDL 4јb{p?8pBdhIq6Yz,DKcMX,F E"T (&fb/Ec)CN.%=j)9";;&}/)œp4\TC5I^7ZN9 Vc: !y'c۱[_:{dH` D@qlݯ+^0+?kmhE3Cl h݁7nƐcbqwyUС߰޾hRQ7￡1UDiD3(`oSy/Eݥ;6)&4XR܅1E SXőH\E%$+;m;ל97>f7涸}YWyl~_9O7v;^_K^=/ϓ_߿ϟ{}>??}p_owf]%wZqJx=O0ۋKݝSjp3q9~x*$8lo[0I/k9Q TI $yI)+(Kc)ϋ^nl! ?Z0{^u/=̗/$ <U HdY#Wz#; oo<–4IS= ) 0z 9$j\4\BIğg,'LDvW]WvB m`E:5 b^ˈen_R̓U2R9S'F/ޑe$hSFZ=Sb5Kt~zBI!?1:gnR}.'wFc|C4=-5']frNd `s%tw?h^g`Dvڈ8c6 Qݱ2dG5RVh%c= h`@I*, N`V" )~,{PZԦSJEl/ (TD}! To|^g5gq߭ICwOlg߱0??k|ж߱\MnrzVdѝY|#q# ':㓴?}_TwK+dxjRGD4Վl])_3Z\2ƒc{b=릭~.N\.܊z5u͞U˶|"mwYO7_cH7{Ů_{ /5y^_䦠fTݬXͤs+Ս4Bׯ݊M&!*0[>Q&Ac%ר.?|_l#D[F{W 08(2fN5@ l \Ժqo},@¨m{2Ŷòip>oӊk'(䗩 í#fctm1(В{hSQ_R0 h ~sO?/|}.6]s< j;n=6AB zfWafm֬3VU#VYZ`quhTPӠڲ-UݭIȈdk͂eZڜ><\V4[) @,a[zq?'bR2SJ.ZxJX2D~阼!xW&}1Bj]̔>Mژ2QOKYK ڰ Q VTtן6M<@Y4{Yg ;"4#JnL8c $,%cW+"n.]dHW!{-_=-ZCJq@nneE"(XJ6j/~;~:9A2 XhkOͳJ _9U}mVVO]\wr{uAjaJqz޾1kFV*DP;-ɤzln8(ZǐR=f|Z\6hPېB:TҺ N& ba},"w:MXqllew+HCmޘ71L#mz| ]oh@# @n3gTCMi*,pzALݿ 20s )LJVst'8Rw=^%;cQ{"y9)<tGc^Hf\Suw,hGQAi@xwRxJmNrwvGaIwJ9k a,Ki.jb E5-Y+&U}K8[?mO)ݲN|b,M#PF?bM C'P@}5<&%qU]%)mƭ,0N+"R!'u&n">Zd)2-F?}7j;i1iN>w[uti!1 Z kt^`,K7Tr01[\ Gf:/E>;+_L'ho@ mHDೄFjre9qc1`Fd@[7:~+HBmI<(ryKUZ`Âu޺/&"N@:u߇^c3̟Hl)x@A4j%iyL sW fj =iۯMٽNp!(LY`60[uww_ ҐD+D]Zٕ ӿ^?l%VG74"1@8 ǭ50-) $NnZhץê؏A[ДC7dODѿ c#OkFRЁ$dܤԓri{N/7W3{{%rl1TJd`1Ent2 d4轹%TBs9^ߞqx-l:je\Wbȳ9 ´,X(6JV' \U%M dI3ҢpP3(L-#q콓əl#˞rґQoH,p\dBh L}\$ 1R,WNat ą'+AfE*,LOs>눵&L'"  %ЁX#akkA*#_Gu}>뤴2A0H<+giV]Co+Sa5$5 5 Y&e0F-Uvs}ͨi $P4j%(  zĄ5&4#K :_!2:pw V23j#6|=וOoV1UFKKA1єʱJ[yq1_gtmBo٣vᡁLoME c5r zJd@P}]EvU u =R,Y.Jj!@` KeQK5Ip8]( $F"gWݾO9 Gqͨvhe2j(ݞ{%@2ɍ2$Э %ͬj7A>#YN321v'w; {L0h\#Y8DZ]lXXAw,)T`~` &* }&I+zTg&& lItܧUP ,Un-GvTbq XH+f՗r,F`F#%*x vOxp2f#<=Q 0XlMsT8 Puin,{. ֒u,6 Bu?vqÑB#|$X-y=3|x˃zl@Cݾl YH8Z1(lrdAZ6(z0WrlG~FRj5-$۽^Vaܛ٪sϡe2!v= [,5y76X6YtL Q`$1˂A^Pw'k}jїzj]47 !CB=~V2 KEp5V//\_K哊 ,_QA ۑ ig$odo_4%,`b6^- nc>)9uyn~i>g9S+Gk+b %kc,e˯,0ZâX7 ;j8~&yu:wr~}v5|T<όNy?Ӯbh.}J\.6ao*<ꪺaiZ99/]+;stRJ?oq\>//.6,+< kcWνǪVΚ.*qÝ:çǾ2<=t>Y"yrH6qXvIGEᤀodMe`38{HWN.sb)ޛfzK:ɧvGݫ-}0ۓz:vun9P=b u&:;=/pS{#^ljٶ/e kw{s 5FruA=I€`&oexln5kk6ܣu^E۵ zh飣;]42U]L )V2̥HhRQ(nzjhgHv3n@aq@{8v^==uPx]=-vpͽ{A! aAzu@=7>57F#Ol`@H`$=Ą8cIN4@}ǠJMSFئ@ A5oGOM Ax4J<UH@$*3})p6m"E-0+n 룭t:AXEzd0>#Dpyر8H]QaCݽn=w˼y;Z6^]ϓ5=Tui}C/&4[npij-=m^{F_oounNۺy@խ wlXtA܇cf͝@=PUBIKs<vѭy9+f&©IP>Gu /fh(At5TVu+gvM힇a%PHw֡BѺd5`M|ɻ}vp!@ @Pwph `N]vFq{ܼ<]|zzi^hf۞u&V:tnx_^{=gpguwvt,v6;Oϫ}k}_;{u91(yՇzz9pz$zΉ`y}fVm}+$==u^:|w)u]v{:QWzyy[b"lýwyӺT\;p@\J:5J}@^wϯOh+&l9mڳke`̞ظ܆5d}̾/ہw%AC|и2—!kYڜuP>-{} {=Ό\> @;}7z${ |=>{}7Ue::;7 KM}ܹZRa(rzOm>錒 gѤ}[O'qϱH#dW~Fq0l\N~`]4Eh3q(a6ʂyw`^R7_OZ{(GN.F 8s.vS wIҮ%+iXp{ۢ|J1k]+kقn__85sv?wƔxW=Aw(0IRgYh̛q1itfฯ˹r*JaLBYf1P\70c1֫biEXw|҇/??TYE-vgf I)v.>ZE7cllj2XMy^ XUy(3F#]̆p(^aG9>VvuuS~*X67w培"'GD|32tit `q{>.Fi .*Td)&L4,iIBѥ?s１hQTzãA AjT#`ӱasA=Cn=@FM W=;KC-NĦ~Yfp}Y_|PK-|϶DM4&/(6كo&|ei兩H'35 _#B1 ߭c$NVB5SLըkt9泉K/iS_=$%S8CC/[M 8K)QZcATF|k)0!+qw.P'P_Qig-J>Y~f,iL|C.,Ke@]iE)'>sƲ_?rϹ~F | p1uH뿬v=A{9Rw3:KBff "Q Dl?x=KdWBu0n$D^%}aS:xou6vzlF/Yl2z~EƧ?!KN>!Sӕ1CB;6 "x'?78b)h)#iC@$x(i+oowf*y_T|"\4z뗩~G)%]cSFCf粴bPTLC#Y6!>ݧ{ 3 )CABWU n-(?fZs#"REDQ*gݒ ,3v_-Ϊaܩa/5֫W|3qEuA# !"XdDF=OwG>MiH^Ȥ)IH?N'+0M\nb8|h7Ks? C!+(ؤ %*mj :" A.=sӟ~ U!EwgGlbIP)AQnqep=2ϤX4z"6gIӃ~4'Ӕڹ5ԩr#CeH{2?xgo$y%!~{pEaV7v).Mف9[A nK,qLNFQ/C 3DKS}d/;￁o_'JZQ3>Ј'dhSљݴ޴z{HTx=:Haj"n["B Yn0S>,ew|&Jaz~9' X~K<ˣ ~eˀ&h7s-hć̔.n_":<˒=ӏl+DpD>] UѺ0!Q@2j<"EhRZ>I7f#v5dB75P;yT_g17H.jRK/6o->wܹz0/6\'mÐӛdxВYy7<xN$Z: II f2(s\w&6WlB mzel 2U螺"']E}`@#K/6?CɆ~Qz4[[C%Z=BpnFI MEV 9\?s]|?qE*} :Hq;hjz@'$oi2uu !T{8GSJiL] i_OnDXDI0H*<EU=(@6Ԩw a`P-(Q)!&Ωvg.a{Wnf»f'˾SgT,<R,Q)6dR&c<0.S1DY~PO2K7/_<ެK6jdgY 雦54ЀP ApZn/4ܞ 䧟>;ݟ~ib7ytKb-pHORdy\tLDp1QTS$蒪X*"% 6h95QE(.2hJA.{qc%cIvʜw-Tt??Elאo0o.F tFg(t}.^|/=}}`Ay5?|FbNXS&B}IJ&HK i=Ni}E`Ě!5Y~bo=/Z6ET`jB|) _l+S2P!}| @ԠC%L&%&כ37P^\Om<ŏ}qrކdlJœ(nl\ncE299˴3X: /rKBnҰ 4Gzr[w"Y ,") X2@Y^&c ?պ跶o<8;.ŨFHBh !F0F -A2]A`)I*04P0 G(]u}y Gv_luǧQIdziE"Ws!A˴q6-eܩÓcII&+(-p*u:a]Ŋ[f'y./(I(b''j52@8p-ԫ6˦jĤgx].T)?SEI,(Q2xG=O/58jCQuC0JF̂JKD a =zs^62d$hvm}JXJJ8:MJ&6#[p826n/ $l|)-FC y>y VSS9a85}W7xIS!'t8*/_wSX-<_w~UIS]O ;ޢIc̑Ff>7+])"lf$/t4 8}P[خ_#<2 Y{M#($9Y7 l#L>pGga.ɁgAAgW f ulx~, =w#PԞj8#-%m?y)4/L5RxݓO*whAf Xc_%ؖ$/dw|R| Y^OtlZ NhwH q]P .3ɟzxr^ ^6߫=Q6N]qpVo"j\"!-v p̕q.,މh&,xLø"4u6/\+ua䏊^">F;* G˅x0B ,dmhl8ۼKw΀$%|$MA(k29 8$tx3moXf#4CU"J\ґ"5\{7V݃0`drxL _V@b̦ LO >K]^->vAm1E#_#}L01}ݞ̋]t0o0`pu" 9fEo@#f Q0e4D 1.b@))"`x /f@ūE.KASbdk@)"R!A$`fJ"H;XVF2G rmd|o1j_!5:1z$ӿ%U JSg'opvEI" 2W[RT„K _+ ~6cQAb* EcP1  12*iQqDQ$a'˭ 1RTǁh;'}yUH0q6K"XW3- d1G&{Ayԛ[6h6M#S[GT\0¡&Vv:~U*D(mjC2cC?opAIL 7#%񙧦f3eX6%ܽ~,B[TԢlg4!J|\6t3|dž\71όJѠ}Ձ^];pG25-WQ-ӓ'uUd鳝 U0+ D |Ò*Ɋ&hAk]YX"D"CDM UH B, Q]jSt!̪hC&$&&$RP8sAEdQe`TBdL@BIhZZPFlص(׿F}\LW[A&8:K?^. FY2"mbLv}O},1W1^|[l}l~^48˖>OCjiB]%D胨|h(TMyR\tB:[,uY^0 k* RE0T(R$RPRd Sd0:~[V&/9ehӨbH(4տRm_?K}=UALg-`Yrʁ.Rȱ U]˸l D?XQ-E.Tg |z};ċm9C-ibS۵vUҺb& <6^('zDk7|R^I5$[5FWJQ8"-NuoУ"p8K^Q;l#,@#RMof?/mǝt*ȵy,N2BbFMiw.j=]{twOBhwA`G`tL$"(ӚQRlp#BbIlІ!COEFS<M>l;-q- *>{$;0F&AO߮]Wܜ$WL;+% 3N1VX 0uRlȬt$o/^T}-7k@ՅMQ%]}{+X:}}ߠٹ=JoqjǼ9~/7Mρ+C~E[xmu3KxÈtIQ_TCW׿pa% _"ir1 LҥPQ [UŘ Z4!DIuX_BmFHbi T^ 1LWN**JuLȓ~Yujax>k}w4JsmM7_Bؿ IyRܛu K2bm_FRH[hˡnZL\OP԰ kG= }oHYm=UeՙdC] X_ 0:W6ڴu444#A%bC0J2[puI)k;z OCH[1 dEdWN}GoQB;E//L{\ͭgEtn_[BLOR_ D!VEwu: v;Zm~i}o 1{uK%6AY&Z7=b'\X(D^-Xi{/ȌL76e0 !ύON "V/Oc8<@Hdeꑣ{GgD- +4e[aNwIw\fGls(2jc^/}jP5/vG,,UbZ_3&"FRŀe++jVԠp#F-ϋRyr"%4 XkzggG||}駷r4%3s:~0aRIHQnCJe֫j")% IA-{n3FLca U/TKb!{vvF|fݍ/DL*Id]խnOpX_1}aAlmjDBH{g~=Kq7g&mIgZTV7PKGT$W.NeYv`fYeQ [F `HEQ8ipgu #7 ET%64ݵwsu=s>ǚ@dIé*Z,IL%J )T1F4a28S0 PH*t$&JI'J aj(h4EyePl%GU܆ךxнMxQFljխUogؽ%Sst("b$Hzy/~Ҕe?()E YI $ pTyc&H"1 sm.q F8Ye 6jBrÑiRz#Y}L=]\Aid.M8ii@pi yg*mmRR@ρLe*$sW "䘁"hH T$ pf枩P"u*zQ& HI9$1P^yA$DWn 9Ŏ 0DcV?_p̬FRn6}oT/c |2WW2I `~l ] NsB֡aE'[qgbjxZ?5D; UO)9`:cXo87?G1"oI3ȡN´!\J`]G L|Ub%ʖsIF1;m{a|CuDx,dQD!]q3kO\{nF!m0GGPB~6&|Is.l|{ofo"Y$:Qu;=wrK<%m}o;]r%Yʅ#Umi6ό.!1Iq6S^{{^:66欰? _k).|YԶ 1{LX4ФXy_O}f,^}dd/76JU8N(V%0ې ˗SS!Z^ɞ}33v T_MWT'$:g%..6p|GlYT6 eD!Aх4fbx* qNǖɐ 0"W+sY{cQL^ݨ18XR/ܫyJ^ w-(ߘq+hhN(rBL${~՞Et}-MSI:d2EPXw\(5;(R2TmĻb" sckD-H*QVy\;'yK:u WOիz 44P @Lg$NTsӱGF6%PQ3H-3\tq90q]4qD^䰀+D+Id\Әd{>Ϗ;\ު6AdǤDe̛zK9PЌLl=.Y=~$xZs8pR@0v^^ u`X]`8<(@䞺su!ʇ7qFսHx+?}>۪ ݘ`Ww1lfx=i9 UN<ݛ_w?Pw7m5  nwPn }+V.T:Wȼخ @Uh2]͗2FSae(d&\{"/jq *A -%<3 !| 3>՛ABw7%{/H+uj&!- 'p0U8,3dX5x]Pѫo{ {Vc1O=$")w7nur>JD;)xI #pt89$HsH{cuVL ȅ⩊3&瘿` D")ŸSPC jK-{ 4G6WFf08_?3#}-P`&ilg٬ / v2,|"|s4xž,IXu?`izzz 格L5 ~d#G0"\V]^e,8!sn~ؙQH4= H~.Hp! R. Š>1Pw3-; ̘t #Uu`_U@.6)}s{ơ(\p>"fv- > rz; Gb U_49N{-EP򐩱 iHzَ1w^EAMd9 (ԅ$ @%(;y,SO*L7kt188Դ KR(rX89JxC+Fvٟz) K髚)uyַ^+UM~w/9T9BvM 2 #.C FF, R$'T0 2aRB4R.ڒKk0o5mc*CoRcܼH1N.-k*6S5A匄ƣ "zw*HFF>'"=PS3vYm哸=GQ;1}Îh+61 T ˍoD"Q:L -h?h#:t)hf{$0)7u衧c|r"}Zt%%JQ5cPehzNR6J 0jHXX#!H${3'8 󂸜FQ4QI}eFJ ^Fް5] TJ oKwR*1 BD{a$ȮZ=v;rNoEoxP*|nDI>N2].Hk"fjD }^0 i\Pi̮8*@Ģ)>>9鑡[NвI41@:'y/OV[ٸ;LAGQĪO}7ؒWӧ-˫e`Lo '.RZ)Le"jUD)A!eYEZI2R&Jd$6HDMHHTB$ID jL fji Dpn*HtƖ^EeN:VҔק ꅟrdY~Hrv1d$%b&[$KTOaKI5듎H)B(N -.u'ߤyp /(kغ򱓵b<" "+戻{9T$hOvV%!y% ))$e459,ϵ BDn՘XYOYG+:NZ̊f. Sќy4kg~}F)…k0H!vMT5Ӯi< ;X$bj1@`uF9hBNwwX.'[HE!; Bk"ۮ֝@5$!NXCLQWW&)z`Eґ$IZg!3q|3DS1 m#W'@`eXSIf ɷD[~", 2oo[)#XDSP2I-sx^6.˴-[FsPR!hA!A!yD+erW2e8*N >B9B5 {s$h&j؉ۖV1k \#|VV ϴW|b*EX)AIO6Z1E78Yb<=\]]^JK(rҍsmGhq")-%Ji"քdGB!q[L:l0a8! "gSF=RH^ěͻ*j*@KV櫶/S7;o{%#)]̘ZqhBWr7Ë6 Hඉ_ƫ& eҖ 4pZ 1;ξJ}V.#%9{tVE fFb` NJ 2N|*q7g#6Bfc@#T@XjP% h.:CToVg8 H :Ӊx[tsjya!+-p6m|\HqXYdIEA5F$T`AFDYDL,c&E:+H5elin4PӜU- MF 2RbCd%S,SSRS+P4łt",:]Hͯm&,zU}O׳dZKch[Zd53!*My͵tma'9U!9z4XdmVI @&E%*T1^Ț!̍"lbqWyFg=%1Gbtіer 3VO_/ݎi.<XI. s=nCA-`&ŶEʡҲ` * Zu]0A F ƬIXY{:1>WG 9EQ2P$/t-<6͙b J2C$Y>:te A'uU$o"v*iڄ2J\t<~TH$s>w5ߨB[4vO3#agID=yo&O oE1.9(54l65%/Ux Ĥ: Y0`blh*z),4 t LQm)٨IkٛAl {ؽU*ƈUzJE:0)}`6'o*LF3 v&QrotdiHV}:x!Bjb"!h3>}LQ TL;gw_?V xMYg3EkbT©mԪ욫"BK h_5>QRH "rkE^CEr-Xr1A|F &hymeHW۩p-hbȗ"PIݑo"xn1qpǏB7+*I^ ,^Ǒn֢I!D"ۃ?rSx&:)[]y\)6w,-t+s`Dbzr %(h1O>m57K3kl"oޝXCG2'CZ5N5v2og{xQ?co !Vyq .wG噀T:u!'Ϻ- 堪Dž~c^Bz6~+קtmQ4"itc:($qGU, u#UFX*m F2{#?8J;B@pv֞J)W4(a61Tb+Y ~U[7${jb<W#ՙ73W1JxXTíf=%Zb_rF9-9`:N_D(w 9 cJ:g}Cnyﳝg4v}}</p%W6( `Ȉ K񋅼!C'**$1e)p)µ̥";hCZX)>Q)PWN{٘U.VGlcT9U KjעFn:LϭPYl̮"'VVuH Ƞb4(yeP q xQgUcX"ALQن;o[(n~lzWX $)DB" jýk4WѰůnN^DOqb<㩢>bh|VX{و]d!} bSđhNMt8M\ZJ,EAV8&DZh)"-|/r;xaYPzlpfi*g2Um HEe-̱gESnl!4QEmF:I5ڪ5[_{m\&tjUbq&a+;SP&Eԝ3ǵPEE C]eͶ0V!5n" @t$}ҋ$Z.w/:j"4#vbbaf: UuqR܁6w\P(a~Q aC 1.BA3a'Z6 WM2}5j'Ϥ3{mm{LgAX v;F7WH$(H/&Dz r 7/XUwn֮dקR@ H0HQѮ mj t-6xdnSJט ̫2Akj(k++>XaE`E6sM3hMZqj#$t{exѷ(척^RdcqRl( a3U%VAb, !I.l;esoMFjwR,|Ǝt =_hMU25 j%%+4]!n!L .iWpPT,jZHJspΣ9@)i`k2X㓪;ʷd;Gqr9rnf&pZJƢt W@Ugm1Z ۅQ$$@)! J 6&Vb< '8`3d3e zkwXiTp²۹K Ce,1$0ƛu*^ٟ C";đ2+XЀ9< ԣQSfU8 Ób_,] i35" &PrPˁB9M!*v1%$]Yũ ?JmDA r`́&2d!r%6p3rj]dp! 0zJ(SU.l1)( ^QN Qg@{(B% +&lBDin/X͑xI0RSz%,0*v4P{TpRs+_]]ҭB5%L.-/%R*唲!"I ePB&@XS @B ;)%rGFMw= oq{QC96][{=pǻX"A ",'w>՗{0C]ީV"֧@[moCe [9Vʂˇv-i4G_fFaq5D@Hg]H Pѯbh!0(i!4f<:3ĄLІYU$E֗9p>ӌH@FP*$TӐͨʈ8)Uk\cnHM9tM?f8!QpeS-=} YhhF%M] rzq/IxgcU  )k/ؙ,8`j'{'UM2p#%>7!`%=1̙?IQN$4R߉DuS\T;QDnLMӵ-{#mŒT_ܖlV",~GjVcEUiUn1(S>4fYMg)}}HO"*ژsx4z6ku϶NV[嘱P)ԈYr',@99 d0UѭOd_'kج>oD\ˠfCm,DJ 5OAl}yrW Fw'ӹ9K5`9N3)QBe$_ɉnQICΫZ8l=>nsc+2%^-&ztן[Nz}x'.O¯؟zy%Mi$ʝu.qe _T|evRtG<йޞ %@~sr(=';oM H^NufDX!2h1h#g[ ̗N%&\;gO>I?C˴o|ib$@zDY<*Qe4vE5,n`.&/8~9T؞ Pna}]OQ֯:,HJH 9t(kj/41)[T/OWTujaO.]Ӵ4Jipf!]3D”($#AID|}_ >X~YrK~;%M?~GQ{SNE#xH*B8/C;[})׋[+*z埵|AQ5!`S00Bfę yYyvyL/!9qB|v7$c[ځ;qSٞWȺPPSQ'M֝ff6|Ty!*g?,T /+3Q{K{?".W yɿ#%/2ǿ'686w=jߗU32b,GH67E$.E FH gzY(`05v^O޳U C W tӰQXHG`mőLfHW8 $8Ra[F͟ʟIa~0?m#H|@cJ4GEو_hW!D9pٳG0M>aS^bHf#ʕ{{&I I=KWקHu2eCjR:$E#|v@e,!GML}+{^Q u p-Alb<&C^ƢkE1{j=NNLP#zm9%K~Ω+c'?+IS` ln 7vgAlzWKF$PVu2 %!POyd*мZEAa;|];}Z%8Eg.@X]?g6/%=q/\A |ns SG<@ nX$4tB!E& df0șDU6 -JR_1bWf=atVD3>c*MτD #HܝnS nk@Xi38"yNe|V@PۣIA ϒ 3ч-[Xlw1ӯ*FC:n^ls^pDݚ U.3`0e0%d{# m#+3͘} r_ 6&n+/n $HHp& r ;c2atS*L b9$k׈Ifv;aHժ @dGޟg=0mfE mNKIfThv:KDf_~kf4q.,qɪMtъ庪[&bv+[j(s81`=s&.&:ȗs&61ܵYI:Ǎ& |((( VIU&iLFf^:6O'g` $BF $Qƥ:i7ɩ sr|[֣ Ay;!Df nIi pѥ808U'ߜ-Xf 7Vf8S7:(V/j֯1`P:vM}O?&z0 h#Dwg񷴦yAϼ|Q)U3ގ?8/[ERBVUry,dt}M!71Sa˴[sA7_(`¦Q>d"";ԳuLƚi_9JdZ =[%or戀 zt:pƎ6w 98E(%?#jC!yR]pEGMU}s߷f^<QUD~+=mp8O%&ꃇmLpq9.)R󨣳#oыnU3.iLP qu+ax{dIԵ a+r?ѹ\a}]V CkHrdfS_r•c포]Tp]vfE19ߢp]w8H˕[; 3 q$iX.oe ԬD_JҭT0E." 7Yύ8p'k<3!N- &$!A Q ux .W@KVX;*fH[P afH y^a#|Κw^3E֚a RDu8Y] Ʉk\\ /\֘,!Trxs(TtչjI(t΄*}B-o//!C-f[x8 xbW|VI(EdAQq$Jq(=uɐG)ݷ}ES³@Lܐ-ZGτ>6CerQ, +MY?!R'd$ϊkofm)Q^@r 'bjGy8Txpn.NyDŽyVe=أsrH a9mjƣ(DڻCy؄`wu-&.tXrlf dl/FiVjsSLvésKʡдog I D}!; #0lNA$˝|E8a= Yy^Z帆vlRy^6g1Y D_#RPEٕqA|b$NBgHl*ފ5˜Y9(%AǨԀQ9 =ȺZ<AB" DƟo"g(. F:XC3"hmJ]҉'ܻF% g9E.sz+ɶ7T( ?!,z,A1YĨwiAۤ`P﹤텦T$C!nJ8P8GM.AS}(s;0bT1o}!.rB;3zd=U904 š >er WmbB3ߖyK8N H04=9y{}>GWT'^\Vt<ҥ +< aB0'4ح7թ+;Wp#Ia%v~|(%M`L+\q7&Z k+'yq-{p\{U #dAY*n&s:͋[nSCUA!kZ8y·1=%'9%P" H=%q g%HO3& GØ~7w~gL5C\Gvy96mL|vJr/^o;uSsI|Û{1Y`FWU'(;P;sr#4RDr{s33[q@)%2NqTR6"[lԐlosj'dUqާ g3`O+Y{: P3>H{\c'z߿tRT_sj`эdM.b]f .`db7ޥc4!~bÖ$G +&wuZL鎐y)}ɦQXVkD|6Ej\IKłd]rp`|`ľ<=C7b0Myh M ®}HG},gd_H|08]$І~oa{oIa*6"[Acm`c߸=M_mD@\$n䂹ˍg|u-ǖ/9U29aQ3gt˥5Mb]mUV{-&}8:m% :+!/'|MV&tSNL.Kt6l龒,\^Ew?F\ixŽ쨫`l4\)h'g6ne}w~-OMrqK>8ݦ|2TU}ѽ M2T^fEY\f>H{޲NoDW gIoϣCp-i?~,y1&" &:X+_!ڍ'taFnJqȍ"wqj#ֵ:|t363Gvw?႙E\P"".ʜetѻeY6nQu_rmӢD-sSwݚt;J%]~.3QrXV 4)V4T#&&6nឋc.De"&2h$!@CGrLApxSQUßToӽ*4v|]]&켴sa]E⹄tb`h(e h.Nāfj>:'eAG[<8'ei1&=["K%%>(r6o2x;oOs?JxTfñc2g%[⎳ I@b&}@z(U"cSP$oz^Rf^>k1lj,  \>_k:ZU{ޓ [TR! Fo8 OV ^zt G>xn08|b$l II@,4ϻɴC-{ׇ\3*v繇M仑4y|)7ͩ>^fGEV)Cj9gHd ׊0Bvo"=+.^F} #jcn {MC9_vWP7- 0'\fW]7 1 Y1E^I"-q(2Ս]u۞Iy1<%A%1{~]_sqON($;2~Yi{&OщK ~4X 5E\UBuo.\mmۏ?_H=3ѧchB +w4֒RJ\8t1L}gxRaq3[Z&w#TJOG*^1Mͷ|cI:I4]2n_D/K}d1k ! 틆8U<tݜ@I2d-EFWedv,2dNhJh٤彧2OriѳTQ̔'-7RUnn7Am6^dౙdFNӕ2@YnKH,E=(*Zg=Kz2/nou5d{ק^|tԓD_{TWiE9&AD~.kM;$t\pRb} H@+MC>Ot} -]1+GnL]O'DJ`pDqVQV{@:)\@-T>pKFrJ [S 4NciG` qԯ;>PUŝYJS3wІj&L+2)n."t |U!"iR$)paֶo s|ђ_Z> +][؊ʴTp4T`{4zDwʳ)+Œ2U$ė;Z(a}i*xBI1P\7XKF/U۪3,P;b` |YpjD SB͞VؖS+(I,"Ł זmO#Q| JXuU콉Otm3΂S\Z+)ӓ)ziae9 X3%$)v-d0cи$yS)ȑ V\,/SLǠk]X|YC!!@!.V YlmbC |`<w7cN2CF(&nIh^mh^Y&kɧn+6#>JȤe쑆p3gNFN o\0}ǎ`=|{|$t\17rVuQWqR*]nSGAe:l%T^;c疨FO~@O1/Xۍ0Ocms]%`ޮ yp SX|7aY$t0>p4>D\zIEi [^i] ,s6*C#èYnѼ,*Y-wV>)xf zI.%:"m;y{hdlZdϟ%X(woջwjg'nL@ @HIƶ*[yOusMl\ n'$Q.ԓN\AB= Ey?7>c~0*>v6V"EYy$ucCϽ; q%>KT<]R5E,(,xRSg F4^~TɖO=^S4$E8ayWa7;67,}cf-dž[<ټPJtsJig=6EZ-~SÖJ 18Iо]d ne[l=sr8<7^)EB<Tq~7Wv'c"qs ICJ1m)O`DC6n>^(" !E EcEwݻ 7#Lܲj@HCaAi|z>&(nM(iɼ^ kĜ#]s Djc1;'fnh}?Lx_a`隈z\VcPMox6ݡ@`!:;#(L^>-swl>*þz]R(bȷ$;"/QL=( e{P[ɝ XDxTSJ"Mvl8fqUQoF9k)NK}Cp2g.t84O-!XIFHB#/XM_?cC{`^ :=]^̽+"C~v/HYH]d*BNHq.~6|ی瘓R!UAm4LByB:VokjRk:/vxrr]=q"HXR WluU~/R< ԯFωgB ̾"way)P'_#?yU' )>2y/ɍB_nR,dJY9 N&;L3!I.{aΆ: fvR6p#(H0b 1*^׎uJl'6$^h\$@ $y1ĂķР&7.6Ii!GRAAb-D7/z3p>#&HP@UHɵZo­JyH^\8ad@"nRju흭J#8xqlOm#HޜSc?gp~oגaj[0%m:H"odytKn%x  (LUkޅ0\87You{NbWBlz\"G&E}+")kvxqLewb9],5~u,rNш`0,o+hTܵ_Qo$eYŽQJ"z (1[ nb G"=nRW\Qo1ϖd΢čQIR% FA8šɒ#]3!5Gqv[IC̀oH~& +WG=PE,P'anc03BUPά8N# '`hsY KĮH‹[h|n>뫛E+='>;'@IH+DC=G?%.L Ɂwsr*5l-䒩jdL ]Gw%\Qy/u\m_-[H0#s04$݁űU{9 ~pK֣&;JRyC& ! ?AFog|9twN En5B|iˊ!.o ܑ,4sp?6`,Ÿđk%Q F3IE nso!b1"?`A}AaG?n\kc,m>z Œ3æʱ;XdCvOocHcţ .m4G|PN۷&2#c$ 0vB;|A:Nsi"fNyԇ2z/e<,,vP+͙uʼn wQON-+dƜr>|Պ'4&eA>OwW 3{;WԽ%Mɽ/kZOUj=/$9|Ă]@O>9 51`v8$tH<za؛ϞĀBq}pQa}OY:RN#5$>UobJBrQuZ (wb9ɄUވnv*aɠ,, ENfVγdYU} N)Iヹ@7cJ5 HĆ}x'n>NgzR2Imv q)&'h݃L^Wrz{~߻ӤA4n6Wy[t]~.1KWcc-(iծMr>-茠J,*K}>=qB^7aqpgc}۱Ev2x>v7ӯ!= hTxJ32Cr”γ7|{0|zf~o_._ ]4̯ؑJߘ.n9XL_ah3*^)9[z=s%Cc=V>>!pAz&S z AKĀEOLDsI Z r"sϪiVB= 5;Nb GC3$ԾgܱԢLqv,7np(葶Qȫl ,Pb=9BdIFͶYjI N2l<[{OSKx`E, ߞnRN1:Ka{vȞB}6l{29LS?G1<м%̢[R5qS9Nc(9EYEeӴGB@吘33 '/_dqqGUYb[r/#)4",Uwڎ KiI.Tj =q} = S$og yLGʱkPxQςݥy:՟=C3Wliw)1,`[`xf\ P,B "aE=ϷFz/$#=S6N5$I3MI '"g'71aMj`hqcy D6&[<]wqKUhSVZGGzo]< <'0z\#Vp'YO#fՍ!s`%gaɧSӿ=4XgpP(cERPi1gq=36+؆˵e4bwGsˍ񿾡,JP~.naMNU]wz̆R=s!u$N#lWJUѓǬ:Yk] NSC 1X@@iSCS_3 LSb$4 Ia>Ϩ@a$Q@FVm.wf<t4tyy>PQFOyrw yë.#!}&^FGV@쮼ڍk؋f{a.HW"_1SiOh#}y*;- ߘ:<Ӟ9oiED:w{$3]ע}*γg߄66 Ќ-+M,6 %(pLJ4Y_9e/1#"OC 4G4GDCOIcnPE!J&{Oo43"`E2o]s%TD`ZfB)Bx=$r:C<8!R`$'GAf %kTQ sYI.S^v~n>?zqd-|po:9&7՟c%~ҝBͻ[E`Y"\}^vLr'0̪NTjXTN߶yS1y96rOoY ^^u9bKX^={ gX91&2bNl03 ## w:(w 帠SLk۽ͳ,-0+K{LyjpIn׻;rjJ]&7~'O•ceIxH*O^ránz}Fcģ_~1l39-AA}ҀuXn#UFHK"(ˆaԨĿ7:osNh?!ゅ6,;i%%0ƉR%+±YTG IJLUݣ6ڞ.KYGf$7͓U9x qmEVbX2(BOH>]mHV`v  'OWܧlyӸGSGѶڔ`+,NA>h К1! wb@PlNjh hE_Eqi*]#ەf<~! "7!3cĬӽٚU)'0!wOHy%$'M+? I6}')H`md!hMG"tYMsXJTG4B6ZjBX5uwvU#yλq#',vF{o홷vV{ DgwiI3nJ`qA ]*:b (~$ٯǿ^e6O;kzbuJt4(Fào!ظx,N6-çՈRz$BHtv/RA f 0MaXLP!T@o&CFygf]cBW~G`ooLDhAaȴ&BPgT&"v$96%,Jmi<1IA=MCyzZe*qӝ<ΎMz2[zkqx^sy`̺KA V0IK-3_<ٜc2RK#fDE nMm))CB2BH/%(w(rh41+nb~3vI=3d7d,aT fG~U jToUc?0@Q#K5feʾFb\? 90;y,iw˷ B=]&Aa"$w̆ Qn)H!bѱY89]_Ɇ::iIg]{N`OfJ@򌑈G~rj\6ײi,UB׳$[ X H"ĢbMS2JL ,$+@QHb* ޳##3R|M7 $T׭}W nll08ϰ| &EP!=t ڌH)VA2.+է˸sl _YM=n畸DŽ&SZLdW#*؝djP ŐLcaΠݽ ~o$(t[*@0_4!>PbyuzW R׫y  t3P:z>dNU<SEcוoaN ٨g3dLՊ$LrBbG?GwiMl! |NX` g1~ ` ߤ<4T5>DPCA ^102'*eUuBQ% teXg>ir!1r`pIN iTPgoq8f<{xH24<*^Yw\po/O<{wY@"N;ĔzaTQPs.!)~t2q==;-`AHS Q̒42O`(6M=CaF cXNLC~zB% "X0<ҿ[S͗NjAoRT&RX-quy!hM Љ 7Hq+N‘?_ZXY0A7mת%C"k>ߟl-^'GI[7SvՐE!IexIEHHBId;73Nj$H@ao%&7 N00(ls0/ 5$J! b$Hs$ZYn5zIA$|v@9O)2V9(Hl Io+Z[ۡmj=DIGКuSɟYǢn=FmՏrxJgm'! gI4^iw\H,xäB8dE \P$@04&t-HIG1,W[JA!B!;Ne 3n3\ECqEbUB~=:eb'zȰaz'jI56K: *CAwS@K0!&Tp¥f(ǐärj(;Bu*PR$zc%LGco @P ~4%I6f dS }.5Z4Hm4˾.| fWb"I BV`z<r.thuXI$R_yܲSHI%_3Vn c k5zÇ, !Z@1*: uP{H@qؖ ^PHAu^ٱXvdˬ^e|m3$K+,0u! qkx*Rp^<%ћRRLd䲇WbIM6[c$ C$`~bbw$I ue%ky$t Ծթ%}eso)HTC3MB.kg4!n/믊5gd)UZܲA֒ܪ]I$nsw8q3$y'tkj t:^X㱢!,f$Қ[!|4ZzJSZkz%GCÜ>#R,k<"^4e N誷!tF`_88<*5X RRB$Ҕ##(-0&OQy7P'sa1XS<:ȠVݥZG[g>}, IDcHkApиZ"8>z}]&ն W& V3Btmf*#|ʐH<հպΤ7`IׁHbM aAGaP 8WXڜֳ)9pv؝c^BI:RsYO{l+[qK$thI tl` AEt]3S ޡ$!*M ֘1 cQ !{*VW/Ml:BH{-wCmK0ARO7w>54Pilec55s I% ()& )*`,R$dz۔ތ.f.XC䤝RӘIuB+IX *)@,eQBb;o|WYxzNIx}s60>¹xZbvj(N TR+\j^,a%2D swl=(h ^C'[Ur}BPٶ+/$_#?/ͣ7>rKZ,uIG#fF{ t2^g5X^w{r{@=Cb$$@ $I> T:ڣﵘ sgL]ƳC4^sz37e+̈BBoI7II&vE!$`g`[RHIH !)!%w ]<jv! 7͠1]PY,5L J]$$  mLՔEXYKĆ ͝XIFe6 $"U@RL3k a$ة`ɗD9VHJtQLŢI쩋A$4ZXs4QRC zA@a,ɺYĪCBHW^$idt2@N[ &$u<}wp/r=:yPH$3yx_{HS8Vé$P]1l*<@ԂZȒ֔۫kIbF6GϗsΏSݭU2zKveĿ?8:0c@98vmYjsuQJ\6X[HخFnP$EHBh+!&$r,gX5IL/khI6txJ$$;4'sIjbB@iVYᵤCcCEp e $bC2Pvg+ДUDUA9PAR]ҿEBwEuy~u* r ݸ9,xi5lz9 z͚C(˜R$NRd {ͽܞ{V][ש A-VlpNqeޛ;~0E\$eQ$,J'$BrDj"LNl)ytAεj'4Z{7Pe0S㡺xf3i-Ҝqحr 窒B{$8ܽ/ ;vcNBmjt@ &$9nJN~+PP!~{YZvJƵ^HIډ! &ljox *s-&\|m, 7X-#Ecb54Xh"4Z%XFţRoNճGI$FHo0v!!>U XE  ,F(1(L4Ɖ ZP0,(!t{!qFMI {ޥ!Q> S $A<1!C$2\BP[P'5e 9Qϕ2S2Wl$"BH!kZ@8Y޽qaۉl5C%b= ^ǹRH̆٭(:^}!}*&C^-y|.e7( N$F"TdQi[&̶5IZ-%&c &D" V!lddh@&ЛbLZM24 5!I6#Q1oW1)LL!1)` Ѱh"D!4lEf%F e !L@bƒ)4QK_^lm"E2 ,RI%HbRƍ 2kI6a3Qh E5I,X(Fc@DHh2Hʢ-&D#RVBA$0`(YHRhlK@,wpyr󖶟mW(mzI퍛ʥ {m_A0} bC˱NdDp :dLu\ج(JW4CCw)Fyxt&quNY(*hdį}ʛlRpӅ'wGC0;_Y2flŨ"Y5ƉBQb(JHEkn ϩ5C4 ly.HnXN:W ])̋Z{*B5M@=".plwP\!S\W,@1GLX[Qjnd $o$zX9F9 wy11 ,hM>Hٶ&Y9L%k.B"oT7]y%D:w: {Mo~Ĕ-vƵ4kJ>e1#!xE@3fײkV1!|(. ![XHl0›I)УN" u365=笹mZ2fo9J]MMYMDkxbyk'nң$<ΙlN܆U>X(P-R  (RIK`׬E$ ؉h0-R/WɤNx6&a*oVaFj*05Uy`#Y~<>8t`k =0IJaL 0 "` DbBJIP %Aފk;A!Z!,ew_>o_pY΅>KnE 푹& #VeҪXD2O=\c`Ҡ41'մÑH䯛jferەk"3G )5#|DnīowM9]b)sNs+PE. r.ƨFb5ad D bDO|r;S29d-&3 "J9^;tⵆsL$CMUΨD6#;o22TUa(i@nUE8De0"i>>).`zc^6 d~; Q7km2a$[WSI0ߕ TP0H%^͖Ή 7޶'&'SWd!q[OvuvDo'fƚHS!Ɠ'ڪhoU1CC$.s`@̒ "ɰd')$AE+ΪABܴe3V,skQl#)[oxn:NeZv]ҙ۵zVs$) `LY C 92f&Pi @BDKS,äE `Z"Rc>13Bx63V`*!U%h ¨INQ_Rש]HIr^Y*+ $nv)+|9/׶L-F q9˲҅a`aDHvIrO8͙_ͦQ; wS Z0#'Qu$55ְKZ6R7P0N;%ofvRv]Yo4Cܡs9U64nYL "Y?KMИX䔋m83`U an$& ޤFc:[0Dݾ3ȳCt-j^$Xh{b!SUhbI`i*(OCMHtlŒPK:4eN|@5L׫|0I2Tt'ٙ4_vJϫ+KSi$̒uq !d~oٔX4j,mDXԙ`%5V)(E,X 4FFi1g8C> p$PFj1#Gitu! fbzm\<LTqRp5$ɓ=St<6̖4L@Ó3NI8<| y, I9w:]ȰG$=u &G|mVh *ՓфyUEz/]&x{1Ӭ_0&#υ") E3 xwIN뽮q9,ZR{Dm-&IյfBדwѩCJ[Q)v~߃4 kvtCZU&Gߋp;kvĄ I$@zvPr7Ev1% K/P6٪*L M2([bmܐu @x( u͠H .V1uCE$2 Ke":TIF_{xl˸Mn0 2D#ru&m\ok RQv!s^3h;droFkaWVExZqbՃ\"A ٹMBe v `ͼrLX^(D"☁ g:-w2YId$ra ťs6lCGKd!1gWus6hF[d@ܪDd7wPwDY Xbe0(*K&J!D4\"!"AhXJfF^YC(2RތZ*Jȋ-M!I,$tfQ2Y&M$ R)LT(Ք**jBBj$PCjT33'Bi²M ŀB@ZFݪU~vw}8E(وY2 5& &xZV b@ HM@$~2Q"ߡbzU4DF*DQQDQ`XX ) b 1"5+j4RYfE$RI2&3Y0R4Pm$6*Q ER&4M4)hM!Q͑4h)ڒQ2#2ű6fFB &EQb؍E5b!O]DԆ؍2a05bYߜ7(eݯ\̣F  A"3A4M` "&!DɡH]aDXd,l4LP$1h1ȖHXlV6X@QQe2I)MƤhFKI)fEEc[ c`Q$ )&ѥ#HB lbYJflm$؈K $&6 i4cjqaJMqJ̑dVQk-k2h" (QK2T6lw?uN(L# A%IX!%`$6,   0+^_v9am@l}' ʤ%KZhvFJLce$kǦ)@ .Ki,ŁBO9l f-3as>BC ap3$)!Q +Hb8d6Ybmey5!ញtFYn2S śY  y1B $mI N7]rS0fL%&I$L}ܖ@$CJ6lZ yM.UlBHuv "dI հ5[H_e6Tok :$L3653*\KRuS DX4 &։U6V )C%f34 [ܴ9¡2n JJ \.\~_!~n5V6JF `S0N.&ft)7aBS$ױgpvaj &I$FYrF)0Źj3ϭΉ&j."ALdh6RdPފ\`96YXJC̋2¶ꂳXI*d%,Ov5 ;tB3W\܍v ea-jt!.fGakډ1B7RI) aB۴o9QIXdZ4ǁW "HLC UV C}o~oHgޟGl{n'T"0QF,j &ԋJjM5$11 Fbi0 )4Pj$$ I E5( hm6LQ cPSDƴ(`45l h#6ߺ((3c%hhj$T$ج[$fhFb(?//)QFT %H6QKO}I**0[ƅ"Ou97w,!aS!fa ;$yԕ" :p)/G-9`0JnVO\ 1f8Hr}l's|ܣ~4&Ivt\u8ʙ xG#61$dĚu 0$"d@J,pV1U5 ]LPn٪, ]KۃcFQH`P$$L weŔX4mI-Ȓ3,Z  K\[{i13TDi04:ҙ$gPiB űpYru(„#zbZt[ #0t3چ2Iٰb А!{F# ўj+MԵeHjI$`q&Wv:ጶ5 jfTQ"ۊ32B"ed&M$d(̸diEY $Iϝ|E$_e}ƎX6RQE2YeQP7iDF;\XMqr"E٘6[IA)J3Lbm4&fK-4DlͱIcmEbPLXRXLlI)d`(w׵QlZ--̄M6(Ɉ %!ƫ%DeEQoe 2vfX%Bdۅ+L,T)MOQk@Uu3kLPٲD _2N6-XaFWn\y5ww{yn|n $kmv(bdSm^>}~% u6DžSTz+:uV&%IL̐YCCtl"B8&IIfHe $B,ܶ椵yeԐ :n$? b^mD@Y c)Ax@|%z9d$# 0B 5;бJńdd6Y$)$Y%ܒh*UL֯VW+j/K((6, hk]UjBTIA" (! (t2]$WTܼ7hͣ Vz)&hf-zˍ 4M 7^6d1[q#(nR:*PuPaKXŻt26J/Z]2! jILNcEXӊDn*Z.T4iZG*%!$&%iF*dAlYklKTq6pv'btӍkөصQR.nL9t%PL̙R@3 CزQORt& s$R"F X3JsQ"`ewN!@ؚ VEi7Y*nQ[ .d<%hR!!i*p50J7Aђ@Lb2FdA! (N*1Q:LoēqxթJ$I,3l$$H%$"@IB3 9 -2C 20謻RD;8$&WI#2ֶNzMHdēqns˃Ѯ*i *(aMVi ?wkiRȠ$EdŤm"3JI"񞁑JxHu~Hb0lT3+2'؞$tr'F44)PfDNM6C9|E[cT\S &N"÷"l@-qzȄaR4&Am`mLK(&mȈHmV4]"x1 !bL& :87=B<𻰮]|a}]xPKIhIS)5K {Q[vj7  P_g ܂.v#lӨ{sВx͉h bPK-V3JG or4؋5BevZ` 턝Mit%fXPV2)csȄ4b%0#6t#w 3Jp) jUoI{4o!q&UF.S *!ZK<1W9 o%|,&@Cp0 j24ɱ*4FdlhRcaQJlR Ea,j"1D`T111b F32C$jHL6{򯷷=,Q3Tձd>9Z0̙,C5},"r*R6z޷5,~{{7~&Q5( mƢL"Ze0 -3M&F &*1ʊED&4La76p"YMʹf1T u+\4o9w͔rbm}8Jjƪ)UJK IN"߼H-,#klnBn,bbȬZcq` >b08wNu6u|Lץ1|z>7^/)J.fA -9beee)!EP TL-lhqqELL y~F @ Źe_e6̮,,a3)t50ad^d¥.YZ%PþlĒI$E.io !zm-kl!m݆EfφCFޭE(JՌ,CK3ڴ055baA-/j.ʂX&n"c 7h0IQI@$m̩<:3gezЋ*)ҔPNTd$Ytˆe2V0H1"2( DsNoU~Tj*JaUM$e"5HRih6 IfTY E2EQ$TV2I4jɪ"RQ4eIƳJFF a"3))4 FE $"()4If6 %%cZ cb%1D&Ѩ&bfde4JDm`fDj2 eM)_eJK+4QX*MdF"RY0A%H" @S2?_}^f,k`2 [c`c1j4FX)cEbi#ME؈Ʋ Ra# 2$ɳ 0A1Y "ƭFƓjLIX%IQLL(046!3 b5Jڒa TQK%cF6FL$Sd %cb+,lB#*%cTȢ@wmܶ]DnUR Q$% `4w3SbQvrLm.[i 2C޾$b*Ƈ*7el 0oϯb*u}si%2އu+-}~Ӱn^`DFDF F#!($Hgѝlc|j؍PޭEc qUm5njJ9jqRE `E$kUXR9T8Y ^hliH(,R *ҤRPRYBUɱh DD2CSVV6r=B9 LJZD)IUO3t-XRmԟ! HkMHճ^{ $tP#\p$k)4aQ!ݞ㺭絳>HWO#v2[DnnXڶ&%*$!Ӎt"yD0DXH@S{7K*IF׵Wab޹pK d"Ja$& O|_b/|1ՙJ΃&fz:<ݡ^!9R!B% "`(9ܜؗo7"⦖6[ XRY fLSPep/_<# ̒V}sr y?4 voC$P) nvjHuoaxګoAVBpϿد0b9.iCB8.]PLH.x79ںΣ~*цX9RPWt5&r~|1wG %VM$C)uH9_;Fkz{g7`]UaOu-eXWVifР#Z>X }k->ÛCoqy[}7";KZbs˕a.QEރtOGg8x}_igPg7C6סa{_<:p9l+vۼ'X)ը@k ]h_ADJ5 ?| 6Vz}dnTqEK&1Q~44^;̪r Z^%e&łxQ+w˿9h@CP!-q~*:CL I&=d4x7{{?~h$=3$H%˝!T2[~]G O{{ۣ Bێ eVԥA|䃢9‘oӿ[{@[ ^_ֆEEDs_vM Nכ*-hY%F![w޶EolԕX60q]OM9u:WQE3y^6:}0~`OXs>v. fƋ[ﯼb-)5־vj5hQl|WD0k o#Q}o%DMƽOTX1ij`)dzq[c[ElJX5o>`NFK XSD,g[Gw OBfa"@ɒm80@pm)7Ó*૾C 6|bucRl8j'y:x\)uQW 7}DB5F("S?}}>waBQ{ nbf4/o]^ZZޠ.-V6k}>lS&M@^XQcUi TL?cgїu7Y'<AJ o=؎ D|%ɪ~i@^VrVD>yRRB~TܽeRv2eqf\Z:H3Sǧ{з EC'oH$fɒʾ蠽Y>D"$ !$Je 8'z<9Ge@AIr"- -PRրQn[Ypy&ᆒ潌*4I 3xRht=503dcl "9C>qњ8xKFъ(ZtI/R"H3^&hfEQcOyx_0wEǻ/w< `)yE,TH9M1CN$)1^`Hf3&l&"(#2a2͑̐$dWMCcsȊdU` )% QnEQym_'k:~nCyUU&=c 2T%/*Ki1 YDENv{K0gu+N=a Ay;y φo=G;n'pߧۑnbbR1)5l1NcQQG9huNpTu¦8Epv.eb1L.bU"m:}F"rzܿX+::LG]ȀDD=6b8H/?b^痚OQ`iv1 Lmg#,CruAuNX6آ*c $Pe&6 sჰu:b0j!$R fp" X}UuK-^)5o 9=R۱-0E(*X1Ww]cv-{jT \ Xǹzœ3!Q7ۯb]X;֝wcyXr#]FsNчG9KkQJc&*#D{m^=O3t&N` d U(9XN@UTSQʳ`47mgb/f:`ǯǹdntT K݈{NB[\':[tr`9$zC42ܒ!Ã13zg9:.Nq´cb11{7'ǁ|bɴ12Cq 5 K;0 {/M;G6\n< $[7u1伌hx5Lts19OTH$`oQ`'FFcFl{jdXl0_ *N>PbHCAl6\$ 5fkEYV߼&:)!h}kg$ߣ{%HLjpP u-v]jE]csWq"c(s/5l]K Dv5ӱSD6;IFH:"0 TF~qLM( 9aeD9L^ , fDŹkl_֋{y\p.:z1Py{3jb QLW,>u!ð1ư!yO5[&yb.+5Y$ﯴ+[k %)d^'"dz=Im>AπMӁ{ YHe `s(d!?z$T?? ̐'0% h$B(BBy,$$V>O񁥄eb@IHX@ N$@ M![iFmmY5UВ~$B2:^O5?m?m၌v@iڱ,' \='<{Ł_zYx$$$9!$B@@I$ omj{nuskdq ?!'Y?Ƥ@?„'+UBIvHgHkI[V o^01#sRl,!ɗ9-ȣ(yyYdzNnJm?^#=}I keI [%c?iLOOO&&H$Y&Iҗ+3|qRaj#2s@ø>FBCX 0"y0qD˄M8z֔Qm4Y;tڨ?4­r1=އooW&.SFZTXPͿ{(EiuߥflnI6J*T/I43ϱ~}%!蚚gK <;íͨR,xαD*L"Ⱥgue)Jވ. N$9SbѪ -CpJ&݄Nc@RGmP.R&,wMU Vl^Ou~v5D&$+ l߂,qZ1RoƪunTC*(,@;QG-08f`zJt3LVǽt܆BwIHCd$Bmm1g=8"V'1DabZ2-RM8_),L0*bXGN/ϔfwqXj0΄ 45ӂ$$ Vcύ?cEyhJp(-._v QP=b<>m/6|t0`HUs~w(<Hs{@Ț v|@V/Oy^Z[ω9C{mVZ,] }9:Dގ[+]:b-kʤT7P 8`h611EP +=\!+!z_EڦK(6(3 ډ=0I 2 ge9g{B>^ГpH%- 7P L= l7HA1+q-1ҋÑao4aZ唹+ySRh*p:Cc) Q'ԌpHhOޣB̀+1 Fi-FaU?RcoWHvzO Vv^Lc4=^5E0 Y!;"Y7%Lr"X3%SD0F8ۓªs]d #ڠ` }?qB2:Sh\wcОsiX!'iXoI Q%4D EEcicU:MRgω)cpT=d5L;&"ov'wb:a#~bq8t?!p$b trO+rJ:(@_X@9V[SAt_}clk㰵 5"U'+*`1FC,8jUvbGM4Wө.|]fо s鮯k|sӴa]O nC , ~$$B@CHHRHI3vo $<~WiD'e tHOew޻m &<$%|,f|sE/zb"g]Ƶ{_g['H h(lTsxT`hјm9/`98\?@ҚygW+$gNgO*N.H/=c .!yyߞY-8ov'}T,5tvDqZA-1.Tz48B@"={Z1ulf?NjigbVd0@c ʼn%Ԯgzߋ1x-Q/J("NcǑ2eSQ4:l"qš:o+2eZi||a*[εpѴtqZ SP 447רQz$7rkMc<%#ؿ,9K5M qü}>UҜ ZwtMFc +'=vblGGcĬo3?_5-;F)M47sd[2lJbJ\tjװl4hH"NJRԴ8>mL[vܖ.>BcOeVW^ZI-9t0{Z7qǿ3>l3^ؿ.*)m+IJ%(E0k <"g?/¾𡭑I}"WzXrwDa(*,i fWG&"TR:DҍB$<[~e4?XLU\ԿjY2NF˭ D;YIQ&vJyW(_a+wSc|4[}ﺢ2Ch{;=3!u }9xyN@Qt1ǦR'gUW:-ok3x:!B)rՉUsK/>C@?< F۟/rzYGyjFR fW&V8%`h i49Vkr9Kjs5Ou7/ 12N zR+)ܨu00n+08,NݯnzˤO,CT<ʛ|b-1ݟ} \K)VOtI*]{2ҝsPi~zܫKPÀ.a:EyE7{-v$1Nie=-a&Uʯ_;}6YgɄPN!zg4k Dgm3Jy\TrgڐD:)Ĝ r:nW&Cj"5AzK\> lc,>֑qh $w\e 琺{)z;6S?zqzSĎƩ&m(ff(M_I &"*3j}K\Á-\yîR]VosP?rª߭TF[^n:댺@MEW. 1{itAa)VG~_92OV;X,kͳ/O:m4jL~-Т߯\qL7 s'%L'\m0` -3#1 Ky, t_Qgܵ+|J1|=bCেs-ϩ O-'T7Y@sȘ88- bEu68e$2NZa1ʱ~aww̠΢{)펓. eg8_i ǯZR8cIsaϜP15]+)~o3z@cG|K3f4?2[αtWiuweIôrf * T "VQ;tOLкd=t p. Aog&SHJ<#+*> H$NZPV "46yʋtYN5w649B%l:züm I!LBzBOԒIh0m$_Y@$BoyؐY$;_W[e i$2H# Yͳ`8ol|VyndN 2,!uEIx A 'vp3=T8-RnY5[]蟙_PuƳj8~Fe{$[?赐z|5Š:屃I]uD0h㦛P?#L?}9)Pԭ渃F4TIQ4͗l q)bۻ/D6 <41I0p01-Hdn>E,%Mw.$:_kaPc( WiO9$rWdcS0ʕ@USF5NS\ܸ8q-Y;Ew'8_~kb'x2-f\fwlpcmQz7؅b̝qd-InO;Yt2)\Y_5T#ENϏ| ))8$(bmWl:鄀r"CgG;c}6tw-ߧ[^؟}NА(ii!v> ?A"`} I'd]P]HB%ʼn$^> Ӽ2#_. X䶇4 pRTf:ȱZ q-9;EW3s`,4 Ozw쐒`zt*B $X!}߇bC&Iw Y^^8xI HHvuM1a&19ўxfdvw|vՃyHN>7#=P~^z"q'(>7$m,'_y#'"`Py}+"LAޫ||f>#ψaQcڕNB8AZ]]7i4ߠ  CHp8YiRv.`'X!_R 䯏&by @imȁ~#"Hx4|ߙl#Rh ^rqXaȎپY vjJ:3B_%4_`kibf(,ŀKh4BAFؘuM"Yv+PA-s+_2q1E P"xyE+h`VWiP({rH1Mwa;ɳӟjaRȽ́@yeNcK4a( p"GY.'wztDo(i>ZxcC;0ϊTպNT}$@b*`oscOOf1f_Kӆz7Y?{H~ټ{H5U'2'TC[$d{R w<_~5gQ3K+:dg[ש)F _z ?%=Eq?_,wdJRy!`]:;)!2E}/9ypga@DB\$w?`#>TkojajY=nl&c9J$ogʫ8_XxEbw z? r| G7(zn- S`}wi_˄;ޑm[V&t7}78;̞;)F f%_yso/Аb"D1 _ )!U`p:l,nR|v`+o2H}p5$?Ƥvbb90`K]P4B)YV-jo0DLDXBvdEovִclmMw?e/,}kf*EV"F<B˿tjb_Q9Lmc-(Ya@(,A$k+V,!91ͪ#(AN¨@ ݃`YbD\U`:&H3rkXu_1Bp>BD7 B pi1‡VBW@RitzwX3F率}&Z[ B,qum,rrQQTgX8N8c.ѡB{u`NڶMkZӡ=Jm׳KF1?R>/67󾲽oǜh/?if=AS"{4wtB!k0bgҴYAN@}h0'6$=`k$̔"v 럪oB͗,Fkˁ-Z+e#Q_F3MteײпJƌpL3@1qRapE=)F+XFgu3`1C ^|t؄)9XLJ^hª&x)A sl#_N#L@2V}>*e$=z@ޥC( E`)5MZj[ L1]X\Nӱ).+0K 6Y1?e$ O% w7Ǵ bCB]$, {hգF>륿O>Z@/%h/^V UDOz{-bKY$P~H>OU|@@|џ;`Y0l`[?= + ?q'e H"{:^}HN 62̩ c݈alg=,Aomc[,r3nȢmgcZ.e֔˘0ލ:PE-Xx ie0CѕGkCY x`wc$lS[3pϩNRaA҃{e@C24.PA@S v#(3 t haYQ^ -4=V7\ TZ^o3Y3|腮#a|uƳs 1rQ87<6Ŋ>2AiD9,hBVшh>.mK(X)$~v.w0!  ;_Pxu1u-"@yS!q=/J"^.Buoo| *~ #&ASّ Z]ZpR,yrQ_&Wb/ͤR.XEB%~\[Ǿ=%:8of#zW@ܔ_yde$ⅺ-Wy^% /sǮ|H`Ymo.88XD1x11^}uZ݁QBspk3V4`4kE0,s_⻹\12(bE}+ϖz{ [9'іOsˠul"LmAl "LJM- E2U؆_z/_LF̤U%TMjum _ܶt~ $B(  „w I:sRY7В~GC!$'d ؄HO`K$[d  gD:h=.ja.a-i L|=z I H_ٺȪC _qa(kC"QUw׹Cg =SvUaɽ2YnYg`CN;b9?-P[2IPx/cr̆w<$ץ Hu*hP.N/F}jsTB[gL &<"DŢOj3̧5 ʨ X1\/7?!o˼,,^I׾i+>s/чJ=0u0`AZ^ ҈90/a,q$AFv&d$csl^ˏz8P)Z|/DؾSPߧS$W2Yzvb8Le7# wR/ssX*ZC~riVkf/[j.dx]=C` BjI,|i[KEo%o;nlu͒s*xDGEA5t2#$+{W >#?/K O;bV}Q%+oF]hºgMi\)9SK={L0]s`߂WF4h5c}2ݣ)Vٝ" F ܦ3$ЙF歭9=HKJf;'DC/C׈3H?+kW<+7;7El%x9gZ9;֡ɋ٭sJ(z$ALu,`@4c7ܵ$8 (yhiߔ5@+ZPOGEBK~w*0^L1WA|NmWMCy͕`ybRV(au^uA>]V3Z $vrhPM|EH j"cZ0"NCQBK (fOnVP%ɸw(y%1SROj#Jp&A(fMZ1_<^32=g1qvѨ<ŋxvD1 0 tMG0&ܓL4< y qC-ꁈ[$3u5m41p< C:Ltr#!f!hg3G<oe.#qjZpr]b> #&Q@bvvgE@ז:F&sNJQzlPmfBtja9_#=(RM8,@ 3 A4PcàW=<2'COLuH58 ksb]Mg67mH R"Tk3 VdsA$NTQhMͶ aẂ * ?j1"o)A,˜b(ZQ?u;w>q{9 &9Ɏ)C|.Op項ľUXaZIYQ&T7;qԶY٫$\PA=^!32 TᗥmL]sOqVc!(~Bwoe&I ϕ>x[G]fcJ<O5~X-Rҕ<#R fzb0{|c`÷kI=ZvHZ]F 7w -Uӭڤ{ıvQ5m+:%^}BIZ^ycIulT"'q J :G?ZޱU]&K~F,86zZcކ<9Ih|?_IGhbf ("U$2UM7 >G=?Ձ_o;8/FKw7o]oPPkz϶g{>aR#DCmɐK|O ]zL g̰9ߧ:ɟ{NϑAo /fdb+cAm6Q_)~~^o0v?!⚨ݧtfPQߴfa@^ }\“:;XـّoCRe]ߩi5&0=?c?+ċC 6'ܽ?EPB G}J樞 b}ąz!rH$Oq+V\/H}4{w3sάԵgG(qb7χi=qJfwCMgԁrR6=?!BZc\E1x|(TY+T_t0ϲ1/셗K^E|up>',`G1-;Xo=3=rA}w:$qyY <։.62RG|/#Ym•ѵcELcоN .俣Ls#9H[[=mnB?_ \x?%YږsG|3kPBaWCei9BPq]_2 J8bh]Xdn1]h S<HJ 6ԝf:u*2h%^;창A2D}LI*ȟ-&J2Ul`c7BRCC(Bs*uhjC.DtuRbnݳW )1\vF7t.N5"3<_x!gJQ& :˩PAj,r0·8+#B1EwKBH]"{9z$`6غ9ăq|i&*84PT>P3 cD[T~]iNo~ӿwQ|cV|)f_<ؓ:8M] .8Vك^y!sڤ"X4 "r8@@CŇ.5ko~Cm])|/~rg9,$6oyKL,.ˤȔ1BLJ/r%|S N$,~xl˿!'L$epR3=H@#S\/d:"v~ r=* Q j1.sb= gT ԋ )ZY!jEJ7IJ2*^oiV$r.vr^s!4IL8iD;D!2Ja\!9?}HDh02]))%4toC n=ڒ-pe g4d5oݿa{v}oۙY }R%`r3B_dc*y &jN2a#J}^]C]k*)aߩS *C/mw?{_S7Q`*'%h\4)] "\QB)*m|c>_3:Ca'1tշ\W@{Zc:$9` k\"TV?1Z8 8ߛx;w:c"(ұϼ_h>˪OQSX;E]-"M#mD$E$.|׃F @ϔJ.ӟ[pr?6њ~?>œ(کޤcctPo>cű'`dwjvkTl[]e>>/׽黏_?=m?OvKv?'sy?q'盙=G()ugӃ~MI?do(+v^u<[Gqj+#Q5t~y4pFzl `dK;s?ރ-ZĹ{v$>w6Z?]os|DQ ˲1A@]\L&0_ sV2U^0o%}&ΐ̺_h BN 5>gGxۼx6GmL~jcj%sz;.J&uz9.[&ه4(T0ܸ '"OΙD  .`& @B8h$R>Za]7u2j{`MdJn+stpYh82 /Z&Wa ޜ$x^?<ŞN#JD-tJ}kL |=3!m;O/<wU\Oy0v;a 93u\chT >@ 4&$Ej3Ϫ E,Hg͆ce*CE# rL^RI%ʳ0#Vphc W% Iwzn?&&*`v1^·s^eD2 Yca s\Vp(BL}ɶqeLPhnL9zݏҭ(uMsb *`8V(g ]&ĕӱ7g,! .Iө *ZQ|w~L1t1;uuq'{q~W8yOE/MQKkRp-?_~~zǷġr&; Jv شy] sNC6ޙ)LHi Aw iUjAeNj,B^e.AQ t $!J?}s nELENfC@牦̳000oPI=/ox@0`8`/N?Nհ`18H'G`ݟo~?8 b,mQâA#2 ^&yelAm+h{v"$xgwТQ&(D;A fZ=k40qɠ"{m7C*9!-}2ܜ6qpѢ /z\b#97 R2c#P8-aPyzBtu'9 Ã" Y|+ԙH/KqEs.ûr H_F_,e?KDw Z , ]"Ì.L0%$FSY*3Ǧ_-ݒߌO0s̪MkMs6rz9>q(#l=DfFOTa#a"( G |_>AXux*m70]B1GL͞U5ϰiNӅIR;5X 3%ѹܑ6A??WIGH )׼C r/ %\?/OL6IQ}Sp5L)&?קZ8h}H{M2o)zZOLYn~犾 ًfCͲo2Tm2|;Vٿ{i'KV^,N }6OFI ^XV4n<'^TJoȦ6|g c N={xu(5]Hn6k6y)_bTy\\ǫcKV nGó Ne|9p"q_L9ґs#jHpɽCKCL*HkCC"OtcўQkBg̕ U+EW{^+MM΀*qMIw2Uz:WП/S始JsJTqG2QyKTܳN"ai?#s#_֟Qϱ{ UMD1`Kk4Ɋ)HȥIJνə'EHa0֖&_-LYoP+ Pnʔ́<9_kR2_>)>[EeW鴘͘EL*\-R˳?7pW0q6볧osf+&-i@ɀÕI ?j +S)jSCY/ؘt8;J̶w_ŕ9-L3h>6%;tR3>. [;6P&=x#Ֆ#!,cؽ7 ]%ja$OkG촉6u=zTlwL4SxŰ 5qQs6fْzޅ^5OS'#ubsI_e9 D?.並_mZ|?9}i۴~WHL5@.Q.-Is$H&[*mn,0ݬbGv1p'+QCx.߱h4jĢ)[ =Q{BjCb4/@K}Wx6{#byC_tzb[2v5~=ҖC1jble{o_Wl#c s, TZ|>cRϗ8pa(!Bd`Dx JI@2_KF˩7CI kS3<X01CksE\Ka6f⊎O2cn(mwJ >V$-[ΉKxYgոO`dzGnyV?w dR?K"}Z{@:D"ަ%f,eǑ=I1A" Tdڟ Љ%EbUCz=ȷ#*ٞS<ʏG/cTT~WYC:?0J{FH!GBA2 `vm4=cu2W}+Abh]XO(J;YT;Hy o:"m!xkl{ >e2#Їi*(Ζ[\z1 L?JL&Kf4i?}r0;Uq+#;n?[E /hH0;d)+'}LLL`Q,aX 7 P -Q4l>^=ff?жd,G5P/j_:He$zY> Rb* t $Eb%פT;?b zI&e,dMLmLHr )NV6V,V_/Z؀'c­< ,f6ޞ TEr'0{TFj>ʠ:ƅ7Js=f,gŌDjA S0VHC ,$<3 d s]l!o,F@ 2',`nhܬF:t0Hns^h$]Q=i}18N.tE GQC ~Yr33T##vҙ}w7J FpNcW9oZ.ňUȲ$wD4u9mu)Q0!n<@wzز=(:Oxav˅У|:soo>+'$=Hkl~@ԇ! ΠZVs/Q" HyCܡr/%c1?W]D~cv-tes>>8>gp2|.W~[,^F 3/ v $ACAa $C-$42%{ݗeDn?_ ލB ߙ)$*I⟍) CFy၁$;@0A|} 'uoR5Ah? & 0HdByH`\fo LQ P6")O}dK2cT$A0KH B(-I@;bXD $BUXFIATS% bT*_kaHSS!Gw/mƵ{8#i_/khĘ>Ōo⨅3TP|B;_04 OZS0 9(F뱪|-,fٛ9[AP;B _+c d]V0AdCw\ KdP!96Y ghL̒AI Cz_3 $YLͫlI˹_r_eưOw.3~G`5U1r?-gA'OWxS$|O~JƕӗFƟ]m3(r~|?mƇilBy,2I!!|˹L"!v=7o]ROcΣ=`|Fޜ2 7ߡ&|^/k]Ga5Q'CyhC]|?Sߟ\s$·r@Y{>X.R tAEi(t ,U0 P$Wa`Ncb @zbym9T&)%aF ~]<-O9O\O|\=5,"D7 LMS47?(;*ggt4U |!/{;C$L LR<2䇒Pd w܏}m}k'k {7,HzTa章;ty{UDB~s!'}g'ӛ39p#(}w(agV0RW/W{5-kgL$x !@kAƹDAdV`Y z.u92 n%Ǡw<'AbTp$BRRm!h}k7Os:_3mg#}%g⼄\&Hn!*qi ܜow:W>+fNm%ȁ3%Az% *=6`V7gDޏ.5DIv _kN dnTy2?WO64Nbհ% Lw:R88+PEբᣋzxau3q>3(|:j{dWylAo:o0K/o2}?׍ 8RoJ -X((.񏩯]\jwʖ%7&eH%Tywm v3)Vd^$.I> r5v9=.OBI^/Z?K HG ^7v_s1vCj׾&x]&5,}bUwMWgP{+gD8P۪2f\S )Kѷ0g[T^Z ,! Ss@HJآlɒKH2Cb֩ $ժLkQH0VJ&M UTE$^l5W1C(F [ xgܠn"RD,~˽K"+5'Iug@&u$НZ`%gp{ .F'FGvXv7&"ݲ!r~ژA›=Q 0s:Xѭp"✧YB|P;w1Z m41b?_|9ͽ Z~WL%mLsUD4֒Q.14Q? n&H!FXvT>LUnw%wE{[}}Ti^bBV|:sQ,vbT>L2)Ci;_[JVu_̄g'.,dS[S_ Ɨ]%+NNsdq!vom< όqՖޓe,&K#L*CNX7һy0MC}r- E6{_ؤy"$ok%kIn 2bjtOQE^Q!+i% ^g]-6QP)SF$nmk3 ?@ #5y0&Vw߮v̈́tĈ>vs]36o^=E\W>ZB=_]c=iTnrߒaIa,vxh q=GMiĪ櫪smNA#n%haz_Yk׌.J1 ߇RSt\ S:hSm[h0o.aN>:S8'rӤ2Q;)l{nwM¾ގ_<?zIhSZ ;fPN9hcMOGsJ<=;mĻU-l|AeKz(iũ?tz?XAM(ɵk& iyuF/Q|Yߥ̘3Uņ{ZlO9Y6\}:nn կk΍˹,#$Xy)-GF>w^`wuzh7xȻiѷmy"Ԃ38Qg[a…@MnU샕*>zSZIXUdNa[ݦ±O7 |e\=iIKk+QTŲ/$ͦjCUOs:PS9,ҟ kZTØZ^.d浚MQƚzd y"jd&]{2ь¿au`3དྷb׿:!bgq]S\Sj;*1{0{Z9[E^ﾠ ޅd^Dr0y2zןf5$ccnͧ%C|ɋYz6yoSL|Kjdn//b u IE4!L+T#PK>o5YA^\@'%=(2\e?TLf36K~L 2/+z[/hcP>sA3u0F_L, ཽW $wI2l ;W Z|#[nv"F^9֞;5p\N;!AE^$=suM;V3/XK:1[s78CËC'%OJYO\b*6msb&RÜk M KmO {>ϻMp֖N,ƺjJ<-o5' 1`޺BBs5忀ɛƇm6iK:&͞*t<,K7dVER։# ^,.Gl9!$&tb6%"ct0"Nj  &4w&(쑙UNa5"܅3Քy-кnSBGO3& MMoC F: L$_*m.' qe}7Soޚi͕f>&>v jfór2G+I.V竱.Ii=qam5ل2&^z:|D*A1/e[`K9|Ǖ' o[bopӪ޹Ys\qi&N[RQ wޥmud׵,K*ێ;/SUtb5hHj xi<^ nwE,A| 惡&nbX%)MTd6oۚ4B% d&Ș%RMp5ТQА$~ p,kV/&ᎎciy9"*GW?ˁ集,I\> ) Rj Û;}i1m{z_ÁoW;L~g(~wo <1,^YE'ӏkcZ1ԯ:.ePuqCS=qi]䴤h½G!240#rOSxwnIWѡAu\qJJFIoи0}jd_IN(jt,dfdy=^(?"~.j&~WpJi4n~$]y^]iig'ŽGO P/!FGCIC({|xKGޞ)A:JاΙQ^aeEdxNPP ay=[:j^vLvvB)3t4l{_7v,r@8Hi Ġ) R0RsgJ)QB/=DnV]G 4op`ywP`r^=˟M0۞ÿ9p߀ڴ%cClmx2?\^R|\/_=՛6bُ:McI6|~six=8w5m_6.95$cĸߖF7%&ƝNks>8u;}|uYZyw cW;R-.保Cއ7 *W< 텿f[m' ?(# A^X2@r$p~P_3leٝA1C']M9Wt $K N߹ZN6@k@ ?Tj?M$T$?074C;T [=OIO5'o@}G3.H}$2FF'~ ?ґsдdg~zsPТkf#۠?Hd$QY00S(>^F]!%* 4OZ{Ba Og+ףa 误!n@K `c06W˱ $ zB[@BP<; /o=N! TY/a{%B]}5C/^TTkGϜJUH#aA] ZBhU0P$D[+ v@ F"%1DJ9{ wXm>g_/Oe>gHstX("*_׻1k0LRvɥ>P>Q #$f X`!:>*gt*ntS}?ut4/?Q+)洙$ڿU>Ґ' $4KXՏׁS_qM(#JOamQb]_EcL;x u vyWbfzXwxb ΃Jֈ\(9nc=+?3x^{0Υ`r \ 9 $[j렙?Fλ2=>~Մ-$ R%LJ}e!Șv$U|~>kk~Q.2#zA"6G xJVq6>FG}?MLj{زEUn5}l~Έ-Un8"JӾ㟫xFtpX7%(ˤaF_-;Z<%:\D.})srDZvA K4t1Xګ;9sKQ!7A =@'0$a8_}1 8WW#Zz27|F [?i/s1?7!!I=WsE <\<X@wi3-@)OrvlI9F-v@L cBi75=?&Eg[/xGt1$O-bGa 1EXRCwZI. sT"|@1oն3Aaw^– ?Ҹ>i6NG209*tI?:tKa#d Lh"B>T?U,-!CNXgaqQ89YPqP}ym(K5@t\>aT m(} 4̇߂3²3,>B ڋkL yӟ!\@,V}v(OTE`O1̝+P~ s[B:)VUEi%4$I(R(]Ʀ`1‚EڰH}Dڅ.*5Hb")Bdy[2DA7 >֭m{!$?eL3sFy9.!$Uo|񵱱} c7Ҽ6+Dj$$yS1=iB$66KRo\--FX̶CkkʦIRJtfmZ,SiN~ِ9;vKl8F@U Z) LAz^O}4]3O ԫiE}*8$Y-ϕoT1v?pY,37){`]1I겘|}(,~tÄ]TyLe)4Ik L7ԬcxYxV7qnߓeﺼK0$5D~z+zz87qa%ڢcvܯ{>xp e.؂r |"4s t%ob05l _R{?4Oa 36aۘc2:T>5-.UI$à># ֒ | {gcj[C@R0Ә> f\,띯Yi."{51)&#8@:\\>cchuCn'$)_cAA6%Z`l7B v`]_W}'& !j!o!˺ vO,:Z<9pZOxM >jsP if㱩4;;;62> >W:v8mJF1{s;ݮ/9uږ}nF {n-X]3.a31w ;jrl%khd0ߙ7E UOwyW}Ggُqj i~}**,Vr*_ n1 +ׄJA@{){=,Xa^aZ$D7zbK~, F?ęLl1A ɏKTryr 0FGS,gbw%&)~G/^ZE[=tVSnJ*?$ Hx ۲%N'Bv7S.KvcC!X< _*Hp/ @*G-@+׷?"Ls"B!e?3 ?NR3R^%;R$-=,4$IYFx3|K.CA Q >!nIp զDe b"m1hz~FLGZyмߋ!:E"\U=KXoGw ~b/ŮmCy?W;meYm׏|W׋G~#K6?z[[7͑Yu\י|bp>?^b~[?4 {'O)>eE  ̃_'ROd ~Z~{ O=/ӱ?$F 7DdeƊ=*F?ɥچ0l1. $^07_o6-|_-Z1ə " uL0A'kb\!Vb%Wĩ=K\5J$ JRP- C"6$I@FHID\BS;+/6+{Fo5`4aT f8ȳE1@)a1 $j&Pha)aLhiz0$k "R?TDJP?b$B?'Qܤ`?o. 6t:SngPf,?6W?-_#}6~Y~{CpcKߵ\*FPj#1b1 iN Dq %}I :kgS:,EYCP]> ڂ SapbaJVCG{rβtS I?D$ξiTՕꩦ B ]6s(a4 9ۥ{8p^ga1F,@B:YLQ+\Q kՖ~TFk$Y,!DZ<~]X$t%w$&{_NZjrXaPdRg\(@٬/[ME#DC*0 =ZPd2k$E:6+a*e`¤NEl0Ɍ d1GDpeЌytS["1X@+{sjAFTD3'7$\6RH)K)YP! ²(#s9f^AF1k>Sw5_}YwN71oH:N;Pp-<ϓ[yn&mN~Z]GΣU7=GV”40yݮKPRTNvϜf J}tG9H* )J G4"H&Vy i} A ZD"*fZ8B+: >CċJ`*ufg?)TD43DԀn "h @6RHHLm_[rI[M_0O LPBOy_pM o~w4Y 3\*k>&_>>wWyDRv~me#\-H#L3.'eI^K0?+VL7~RܐF{M$rHOfЯ/1-|U!H7<ϸa$y/Q흾Y:2MW[wWk޶w]٩Mc]9%ݹݺul^N`DEQ-IeS{ԳLW7R`{bzueanVo`3D qzS4Q o@3x$@.NXذa)DgùUbDD $UV0(!z`$k-^k-J[e5cRQ]ݦQ3( "#e33=泩Ab1MP2((Y~lqc}>]#"e }uc$ɀ;і88X96uG e?(RZs/XM >FJvȰ5+Ŏ}dہ>X'8R(sI҇ oj|ɓuG kKRꨖ_TYdd5tB| :谺K2G/NtH{T"ÍiO\1'gω<;^ռ%o Тq.Y8X?##"7 ZF%ceb'!re]$(IA0HptX/w/vGIy9z z剉eSI=Wr7-_E'*ʟMmvݗOv8_nݿx>}YOsƱT3ܷ6guO+4<'n{8\㬕G}!}N޷}e5v ŶwO鶷Z,K],yP=gx?u|R|='cV4nnך~t5~'C=]vbVrGt7>%xڞ~WM:ܯET=þ37~NO_],)zU3{>"2oha ?!_p~@T_>0|[<yI L{]FiD^c63z^Z(?=_[Mi#5Y `Zxٞ9 q[-lbhXTQOq!fݩtpUYVqvͩbLW^kD+ Q #z1@UUvCF|,Qv)Z&v<_;f[Ҳ2::ԧEK?'7 $~1}Ny ]t:xX"+*XZxxJ}տ9/#>$}?ֹf_b;WWN0)dc|peޚ?w7k~eVo?nMX`=}̉GzWЬ3X {{Gם+Ⱃa_\cirFz4d$ xTH*"_^֕z=gڐpC2P,=+gWoO^b'xgg#JR!@):~b{T1~Z<'Akj覉IT{KЕ`+aX{7]/+._-:8̥Zr㷓U{Cc'h\}/͈5);W$8M dن.XmEA/-'ԍ>trDxU<1ʇl0cV9~l9,8%d5po@j63 a}N{I|vpк|F>1R ,5vtP?TPk6e[s<gzYҝQ]%VEj~mwR9Bm'R;yeag,1M-n@nВclA[~zU$y-5D NJ>!"|䧕QLyA[$}wbxi^~׎IԤ+|kx2`=$"<㹻0c^o퐹à*PH.95=Qfg Z8boa=˗ =#0<#I%Dc&!#FleU$?$N@\W~ԐA^ˉO"ƹ@'nYo;8d&-aXH6-z,}\$9[>y֚Hf褦֫ʿf_+iQX]@-"I/5XPlfǪFZ2b7m+ݿ yTc0[Eӯ+mQȺbwV;>EҨ3&u#8tuf;Vz}J%#5lۜ<^[v٪gﻼ&wgਜ਼Ȳ%Tgx_ &b`@͇ r Pg?ᣟAPCMdHdaRAjXR=[nI,^w{$9(M-wUޡ0@p:}XϏY.w<2 }>~)=SĨ,NDuzS_!(C" X'g=:U:P)k,K~AEΜmEkIK&J#TIm2ZVW6 ,?iID_GyןޛjxaM{G S8.z>ʽ~3]bk1mt"/Ri݋&82_W@.%1/;>ԺZ22{3*6ݠ@QB%~PgG9 aD0?QbziրvrUqݶQ؞\uyҘEZ_'+MK$gr^jcU~0z/6d j-SEWx@ce[M&$V3YcaS'_eRf;lW-A)GGN룼)uDk/rKBaj?riw){$OZӰWlvgu^~N-E:_k] W/ﻓVWC'Hres[hi#!nq4QƗ/) Vl^+]3%..GF(uj m^V»TQBNwkXEX%~Yf_wkݿ=ni}JC]`MԽ O2bxy?KA,rC'N[=K$7U?= 93_R]-@b̹l"KKS 7\18)CxAfgvT82B,nNұjS\(Β{USSIx譾+tkQ={̮} գ4WӰx<߳~ꘆ~G0'-N*)o9E%◛zg㟲@30B{6YL0ݓ4keևx5;?W4'П.|:>\y$:&muOA'Լ3hǟm'3yÌ;.:wAǛ $r lJ1Gg:Ogh>kV$*ۀջ LUNjuiZ: ÔOPP-O17L<) E&µ鲉9מ3.% -P'2ϰdZgd4ԱmqK -1ClsѻM~ؙxieIvxm m zۋ3:!%"YW>sO1)'"n&mf{QƸo]ySyF.(j!úՇFPxKͳ,mvVd緽7oWT#)﫝tMTJe&Znf(HSN7Pqw^M}I{2<_J&\Gm׭_ bʹ)El7CMOvj5C/΄=BiIg|mp/scpM>=wzâɪom_T_c{K׿*VW%tge,6q+~[g>^ts4M.l3YFC>>u:?WRr-}! .Cߗ@{kճ ;y/Q]vUE^+e}O!9~Nfu6#vcܤQBWD{HmsAegS2&Ƿ,ͫsy,W^LK=N׊GS#Q.;[,Op&:+!ܥcs)rekc863S=}}^:qǭp0^:Q .G-lJQ,I&YdUMj[`bB,j1f?jA@DP!H(?d$&x@[$җih /俒(gCѢx?'zK*=υi xl Cs(?a8 ,$DHi%N?[Qiݭ!L9ϰio`UMKKM$&N 9Zpo  fj(ctI?I{q>Ps 8 I `ب7'G%^vVxfjB ⦙nyi;<CC͈E3#VIvxNFbQz-vkZ\'nt#;Kou:X|6Xgե‡*J l%;bnq3A+)Z\;#F X].I0Z亩֧b/ry䖆7kЧ {*t*K褩=!3;Y_*i]zT\L vح \2aIM1ꦽh:=zrr@߻?__nMqWYԊz M˲ބ=7Bonlڽr0~sSNB6~ǡ>^]vt$>l9%`re%d1Zֱ .r"#VwZ5Y{$J Q%[fj,ƪC z.L|YBL>~CZVA9 sRɋ@iApL#(9 ~5Ce'gX ƅ\l6da鄂-E@*Ze|S`m#% MfP2 39ɰ{ʉ EPDVh !S:$ֽr}YߘB)yŌ-XkGlIXM!dl@‰fư2u>΃m7>{htƱ4_zQ k M F_{ >vIsazM-F.Wڳf`>+?I%n_rI6N H[7:곙1©FAdAb"~]uq,?m{'דO_~"=I5Z킩mcZHoWuy10U&sVſŅS %vt H S)ԅ15i2Nju Xcq]DB5RHhbqI9JXg|[ϣmK ZU +k{4 cVŗ2y1/I>x<] \t2_B 5z} ҩM1Ad7?*}#eRT-LU۷qpWnM`.d<cDa@u\:VJ HA$ނ}T8i#):ƴ#fV$ 6ޅ#Y 2!<_W%6QUJaZȱS@fc~A, ʴB)21Mmg!fl1¾my|bASAb/4lfc! TM<lp,X@wH,r;QDl>oZCK='tمfq!Gއ y<u@ܺ/ȈA}t ޏ%}2`z81ϮUep0찟k !H{~Gwp<&OӖ~o7:WjU63?>5,<_xCOd1,%pTXur&Voӛjj8-,ؔM{ڐ[U\V(+AU#տRVgMŏw ?gp~ɝ (Pc=byr3(b2ACdyP-cBr?HadKwhd-PSuzbi ke9[X-1xC|pu(DXt|!42@  epZtuz;'&/ riP8~>+!J~L+zʥoE vu:$ށ'|Z #7RțI,1屰)Ԙmt4ȑs )J9[HSk ,Q539 L}vW&b;"%[V4 pLD^jaN.u !J<&lMȞ9,A}m` qGv;B>*DG=?/! GZzğ+r79ho\:}C}Рm)5EKBJ‹'9wڸQKw%QTǕǽiڨʈxlLt~CD Ϣr7}?A"\m !qIӶDuN5#5ו?]9 RwBO!coKe:ڙ,g;h:}!\ Yg RiF)3atenc~af^?ǟEdcQIV,놞*N$n(r ޔH\LTXKj,/l8D<}aM7*_|)hw\ 9'O `Tн'?W'ؓc5x3>(9CD̓b_Y冕Wz6+8TZ Fߓrka/|ikWK!-JYQ)@6ZXBG%*I4Y1|m=i6(Ksr|b#mh0:IvkPɬI=zS5,3Ж;s̫:IUYD+ dfɺCa+ޤ͑4ܢ?6R.jsW|Щ'5 cQ*&i\ h-h ~t\zpdO#0 r~}=҇ P__ _* i`0*BDe#}V3idT*F5]}Ɏ}r]hTU ""-X& k G aw?tC{wɼVKhQėu1bLӔι,l2OZ(P@GL=i ڀϷ3ǖ]SIBzo8D.ØhCehQ{Y{֦+_K=Cj`FBj+/uVaoJ^T| ߪff{4 ;ϯazR^bX57 2~&RKx'΃r&3dq%Ҩ9wcʷ]h&>Bq׿iEt5Ξ r8[6Y! #1 HXBU:WW̥t J!cb.8IL^-8{tRp[-:XNK/m͆FO֨)\hKRNAB]ކ3r^|[T}#Osfʘ~F^sf\W n6Ҿ{EwMl7e|64lf圹ҧP\.nԆUx)ՅWYOg!a}CJ<'hJ\ƴ)c9. Mx[-ɟ`k4\jF}n)l3]ǟiߢ7&@Q9ojΪ]/i7Z?0ΖsZ+HG2$Vԏ5x+Tu7J$xoI䊹uO8OLQJK|e;#N~~n}s{TU-c|ɳ*ٟ5 `$qh1ab01N=îq5z@}6~B$ԛ̯gQ&t?SbOavakks7Ԁ[ԗ.Q_2]]Y^C=R0 O,N saQ*/I#=nL:ڥ05clh\\~%6{wCtsp0a`` D>-`tt\tWȔP.?XDe4Vsc`'UF "%8 $?>s jD$>rGr'sΤ@9ɤX\+@,/mm0YTJcg` 16]`O-Qt" z?~9ݱ l1@RHy/'kNWOd'r}R]8*m{'f?Kk OTߠ6U <=e: r(5471ʶSզj=UÉp=16;I@7VPskEߌ9_G4a* RV0 $?fTBhNQ)$~7>˾}?S||:{{#,C i=MDYkn?gqnpÔ-SFc6tsi,fOnLNť막s.4뺩ŃyeGdPn&Yhn9N&;yw}_$;]@*W\FЈ)zt+L,z@"híbc=os}zJn΋KHEUwa&M\"Ƅ  2 Qt) 尞em$;|{]f h$42:ęIa{Tg =\'AkfI'|]Bl@dO< L " U7(cXm\(q贈'[k|kL6jI>_/i |ʇz.bfdn'QuT3|@5ҒEZ#y]?H=cjmɜP+.{ !NϷ,H%=3gmӦhظEaM#Mn=YD ph,>GaCc컫1OZbh=@wQႁe`V3 ,cc~_s_?;ELsc}[N7 B,#!\bxԤ"7@Nwj1SέXD}Qeq$͈c 8_t7EKF-% Bjx4L{RLoa!6fHߐ/9W?pc) K{6!42z~v6zd?͑\[vU"ۦ'^JBɑMMq朩h0:xAb~IDӛA:2^ըu{ E| OY1-^DυCuhݏйp8'Ew?xUoxmctY-a}嚙m4@&  dQ85TV0,;|ΗS̿ Qk mRCZ<"WGGgQ|m;v<:!ta"0 H, ;!ڤH @`y:[g\HrН1\oXz,N𻷸&i!.^ZeF!ϋd pBٵKB|ߋyJϱlؿT:ϛ4]x.R?7Y./$'e 0БƿrQƱ 0u$_9󔞷!'GHrW1pV?Q|ZFvK4/eMOis|JRۗdˉ쑄Rc+z^V5X@a0ț?qO6m%F_|^l lgr܏ Ņs24됎J 3|󞲳4CO[V6t2dB*/Tl')\q*g@/oEZ*ԵP3\ ռ?:!HQu'?Oiv赕 EBHh*'2էrn핬\ afllX+:]74\:v,|8kZü:~_r\8X})V oY1;}Y?4ibW [jF wg68mWmr}\"̟"i1+G!.81AYvo2mW5Qa܊MX|]}r@oV=Fxۜ)4Rbtc6fƃ-'wC#)f-RY Wd,ԓaƟyl&`~fYMwnlaT2?%'X諘\y޴S5fpP:~~3{I2-r>! sS@b7rQƂȝV\. n !0p2 Zw% <@#LqϕZW b氒 } M@^uz G4^z66+mao^ܻ"GL5I`KEAqIO FE@6xtC`_֩:U9v7@ =rm݇m{fzx?̔T~-})r'qDy/Vlj1>.z]:lD4iMY~F / ECHVp"}JjTKTdT|I~-Rt7θ-]?igpKgD " [ZL fc֯,gFX5gI ъݠ\LBtFNsޡmX`*r$}qPD dTe.ҲA.%EaPŐ&ɡgk݅c@ 'z 3-8*YiLm1XaY)@.  oqNdADճn]]e.q0//zyuk'N,9BuYl{, ߫.&I$K D^ŇKJ1-NOBv|d;%]^|Q۩;'d-g=QO:iKD sޔWm+y}[2&$^ ^>Zݯ9~\xt V_ceXC3:DʄӈtܣE9 ;=SP/S)涊1e#Ưj{,Lv4/>r^ ?0U8u-Կym2O[`˽6Gˁd?Nϟ0V!,ŏє.rLCZ"I$yRp?rJ\8 =ꂉS3A @X2.37yFk#1IiMfXg P$Gp{31G~ׇz9·ץy$2by4CɣX0HCI  vq4td:kki,Ȫ0-Gr["!liA#a1਻=̌oCE)Db zH 1T,wJ)Ϲ}bccfX(]ף&> K{_فw T|j8&}"g{ВJ]-Jƅ +zQnzB/.n+Tݔ5jy@PS y ߮53GW|cvD##:XDల"F8ȓ`0D;1G0g^RJ1k:9$湨/8>M[Z<[뱟]:q8QpD8yF QZ يao5 hSym>~~s@ 5$5vw+Fyq3B ֓̌ 1/I4^;s"=v-x>E>_V@hf[_jؒMD5Ʌ` y}f :ǻ1:n}g2E5ށ$_7)sz3S 8qS`)<0ֈWϼU_i#Nlo7NVYjP<ɚG /@{DL#pZIA jvm8PGLd1h8iT\W!~;>Kz A ӞڂC$QWl"#$)llm*:А;Jt^b>\,$HCܜ[-ygǿb0>bK5z(ņ6G;6*ѨеŎ dۦc' YɌ:OX;3sF~O}YSRϽH^lW|=?nmӚ4RnL#@"Q ,ɚkwR9CXB2 C`C,rB;!T+)%^">"Lo̒xxoM6Bpt7/MNYu[Y^}ߠ{/JyỶ(qOL9905lq y:cN |+56d5EءwLEiA06EƧY9@0FA,l#<lurB_kDQiJF]_NVVbi_X !Yg:h!\s?mz;W{z3['}͘l,?f[^EƁ@BK+$k qI-d#0|=[ƻL)69(Rx|e(\]@[鑵 }XG;˻PSg3"+EFw.> '1yYeU{͜ĥ= ϖq`3)pS q!t >Y:{RPa6=@3v:W>~U)lٕoko5*$(2l^Mֹ]vw\@K>xwMjeg=-ӘoIAǮdIX@dm&7:Y:^ bfedRv%3btl\|q.IЧȦv*S-j x]-K#JSXx%يeeX4B _e4F47{У Mcyud˾\S&m#6 @UY#'~Yy{=5X;u ^0Nեr_OMt}\WZ݄[hv 14VgK>H5RbCr-"lF17 _mZn^%^*'jNECޑU#9;1=Jk hfO=S){Fq}z8k6*VG+½s3=mqmڟ]βcF @Q<6p61ϟ [ ۵\E񏫠 SP& %Hg--96Ku?{%MA$ ~&gv\ĖѾɄ7OЦy&q^yY\p.seuOj}Tc5౞߉5x?4t.B"mlw\7 BT*}sP8 3Ŭyk41l1I&>_6D.d@А/U .ՄUp2{]|# ! EYWwݾ{{f&6* j@ $@l"| rP~9V1$\22 @!L!~!PR XbQyajmKZ)*e} 2NtQ@/ ;yF.K Qd`]@,?\.;03Fk TH2fXijDU~ E`3[[ab3a&i}JGŠ1YFڪg&9cnsOx/O=`uviX)6{5z~7Ge^\^OyWD,35 PȤ % su!/ԼSz|]x}һ09SNg~MX6ΊH,ogzyjf;n%qÿTa$[{'AJRkp?pyJ2  gȺ唵xrd }}s0&FeV9m8;Q|?F:#l*ɿk.*v_q1n~kݎ{)ncQNjP#Y9J3LHDu+qTؐbXcܪ2{ DE"fJ8- | E7h"n Ix MG:I`O]&/!w,U\ lt1%!-Cd #n>Ó"W4I!ISWSXqI3Y\rmÿ\/5rkߗEkD1}hrqyO$.4}<3uLbj*崪F|ui 咣&Y0>7@=Nm̩&d!%izMH@H^ZSǽtv,l1SSazcyU %6GHdW`s)=qoh;{Y]&i׵Zs(~{޻j 2c ]_zM͒xpVZ'i_QR̘NR5>o+\/N K4Nh0\ SnD%b pҙѺRsxіv{/N#U_D-ص}{Ia{|-CN=n{m&xh{nXqoJ`n_0I(`fGcow?H7^)7Oy#;M>V晧^b <Ah8>poOK{>|BRסl]^-\oknaC-6. 8QQBp׫Ա][܍PO(Gm*S{HCDJ)[u9O-!E.$shsT%KEqR^\X-r ZbWEZ}iwez7C7U@!<>uW2yu,= i{,U1fK(=,]v}mN9gm7hZ\\1Og{@Xy0&DjaT.ֻ.KeWUΖSz,Dc, !Z6ѡ]smpmϢx/|σDoՔADPK&# 4['(rA@}jݚČdeWo|%N@A-2t:-eؙu`3A9+MOɀZ~11hqf<|¤?_l2}%(t=WdFi6bw.u=`7轮ZGJsQzmȓPՂS5Og%EWؒRPK +o^jhdvB@Ȥ4g6/r}^G ӟ |ϋd|24nK1֗Vc&s_hu8~F]r@`XH oB7 %DVjCDQ9f+^C~>oz:菙&yÜH$kQ>ּ-y o3g8TP5H )lRLsaG;c;>{*!͍y^)iJU Njk5[|Q^;w/~O^k6.Y%+)`dCS4.\F;x|xJ`iϒ}75Z!~z|HJM\ݶ޷v?#Oݟ!0`ZNeSγ9#@GTq3B Z)yg>]ҮևBZdzQSZK.K{JwXÒ1߈a)cͥaسQns+fAַ'*-M$Hy2[dU3'́1 Pa'JϞ6OZOTk9@ 777ՇOo:(GxQaX|j'-PU5Sa^JΏvoKAYpDFɗ26N &nBqY584A%^E*+КN0v]2 e391Vz~,(J};1D ,O\v4:wwxyj߽x9T>"p#KνN]'\=(R=/G[.9Yz'\,5{!58AJGSr'aa2f`N&=5\b6kƊsb_cݶק}674?s%mrEoXh].x=q cf0d##0x bJʂ7ۢQiTcr~52؍4 ՜:˄,)+r+X1YDYbbgTxu. <͉0OoCf^?(Ο7fX sg0֡k\e98e *MHUuA˶讽C#I'=5KRLfu)xKr!>r ..;(0@d (0ϛ=[:r쑗O%۞yh\Zc&;e ё &ca )Y 6,#镟[\?J_ލTBHaF l漚 8-:r(hIDqd_WSFO#JWUtNub6Қb2qUyi\o~u[fw^WSPB4ҽ"}ۏ];vsC{Ee_Z4r Wv^N{b/wKzH>fc*&SיLZ~]iosҳ uLKt^ɥ]/y=}92dD U{glk?܃VNqͬ.}<0%G8/ p[ԇ`Lϊ7"v~CnM87ȡ4P)џˑknPP^fL_D&wIgNI\ ^Ix}m|rIQM&j7bq©Y+Կ@znO&HDƚR*_8҂Vd,4wS> croYӁ Aa~|q6ρf]/8p [#L%I- ~i|{>㈥zWrš)9Jzp4]yajҼ܎[?jMI'o[k{oKx,ۮՍ?c~s;&= x(tҭCa(FH׫ɤ΍ڜfC;-{$qR/+vgwwVc|$toV#4ml[V?V>Ɠ"11:؄_Y!fhxrT 37/fg2. ()_SP$nKu h˴)~C>>>[Bކh},OÄG*?6w󺏿\BHٓ WBB~;_#gU B@@$ӯ*~o`CB(RZ`R(RAdԓc t? ]w$cBBE^_2M*KM+ ̔b[[, p<Œ0_jH.$?i''OT9Y}KOB 0صΘw~  CYFM ZֹI~2<A?w~?,LpZ֍zO Rn&m`TWxk&&Iz 9T-m 8kw31)&'فws!r1WRQZ쏄Ҁ)I# 8GC_uf01 ǧUZL b1ġ8JLxm;~[<@bL |,# LeiS_jEoIAӣb,  oc!qf)o{R舌P-ZVK1b*YY ғH\CB eD.i d-]&X3~ .XPD'ܢK&ʃEF5_izJVIp8L͚MB\WϷ@A_ ec6ͬY7 ;dl`qf] ɾ̴+ػƟºv"d5\l"j L\w-gηѥMܪxVvuh#q[`0n # `eq[߅PnDdR\WYjrZ W!&1kY.R:L| ctai(i(z68,~tUr0ɱ ftZJ #%@B6Hy(_wS0ߨ(@Yrn{_#F 4?r/қ#GR4G${,fᙱo"ѐiXjf`օ<0eHqڷa:+sieYZ's} Y_ӄVU_?L]8%6<KG⻿ `b\{^NU5WHd<7TirRWW 4>| J}.lpO>j( "Do3t.82Az(l\7+\zrV\:()xwVZoWrqrk˴/Pbp\sI>O^N:Mǫ*zM:In|3wem)aqÕW=rP`yafk-E~'2͏1F5mʧ- ;1"wΤQ;Qy2o^[<񟇡^FV{ msi%2B@`NG֩В%}'&2Gg88S=ZlFK|+H9t~c'V<)8D>fÏ|9: Px{n~l܅0otXnxz罕JfQr'n zl+Wo{..)q wzԸ cwwO6^KK[6$`ץKӖ0̕#*2L"# $Ô~C I8WMAE%hBjEIcdcf1NWcv|037ܜ" h|qUԠnu6"84t'' "H8Hm7֍IzJP&-elj[_W1Z@hFo}r<^ tngVC6>GNmڱb b;o.&a o"PЪ=Z<P,Tȸ33-ō;1TK6mAPޤC*& V2T2ٕ /..._;v彎k6/jTǑm,9iΝT *80E  &BDMOc+2BdX! IEU u7k3+\#}vKI,HcV)U)bST;Jp@UmܺEW@Z).Y!ޔ_{D럥3|mjtGd&:.2,`d)vxaY",eco1ro^kLv6L-4~-{מЕ>nB1*$Vn儥)^ʂYU 'qzQJBYBo\SO>UFZj,pc+=3A?ϑ~]p\|a(N[Yrnl]:+ q*V5I/EJIn]Oi<(b g7o5 OcP" ko?1tRAZ_FM+|o5#"0br!TAe 4j$V {UWQI!Afb&M %$U9DS2I X4@Kc{2Ӱƣ2fAD<-iqlL@ , *4Xӟ˵˭ܬٸ%qj =}v/v$;1_rFDqvT G5T*&آ0QADf @QxгW^UmNȭ*;g~pEI si{|ccxޭ'рcG%`:yz;Lu Pa4z%`yp6ouY֟DͩG",ܯ{+JgK3vo6}$al7<(CL.PPWJsMݧ/;dìK׿Lo! |7hy]ț:[3GyFiBS$>ɇvzϲoޛ(z;0EǕЦaAE 62 |qտxޚЪkJc?AߡwuFpj~m)vͬb#8k[;c֜H۹s%=/{ԇ!P8?Cb]cTʎPG /"e;mv 4Qmf \xݨeI\H_O=t{&)po/' ].tt!д|uΩ6E4^zU ͮerb/~qn4 1on »~׏($>q#k1I:fG*H-Z5CD"Valw=MU ᬳXzbJ[ٛBi#{Y0,ijU_yS*{~ii/ccjQ\U48͖u>FD:MO?Wڬ5 kvLou0.P!b3CJtF6xa~hs6J@)nl\w`+/~u.'M%5vCUq'/fX!fX(4Q$t޺H#,c$phIR0Ў?ĕ_׀q,xd&?@ +j@Hj ˮpqmmw9H|kNȊo?v]羣pJ SI!"ieYw@k:.7vʸh$h#hj,u;g6Ms ;p7Q+gd6(pP65֠&%_D$/}g Xc%f$PI!&#;Z'VŒmNzzvR=.:#P٣Q16=W)h4H 5bTFn38obcb{ }A:, m گ9yk_YSqJʋAN =C'Z8]1d2 JF,Tߟ[6'uސ{-: A1ޕ.(U4ҳW.)_\ʰV28_^)IIY*kww P${0vS^t\MNt0, ) W^$#wV Z4ո$rgjV[n&GL;vɯkq<&e?P̠{ v%kOi|eIBw5hqfū9,[9'mJ9)YNlioö!U*Mv 2[ՠRy8LfRYi^͍ǽeem)ȴBˆU{̅ldγ\6t %}x?M0| *Hk"bԣY*Lb"Xu[ϙ"xx޿ɑ yYo~#Oi\9U3U*cXzTxf<^zoИJ.׃֑n׷ԧg[X!ve ͥS, vO c)_qA)֑$*n(ʾsQj"1]. CR߸f~:.z ȨdA[0xڷ+.JP""Df5 "*z3Zw樥-FhdlBN6Cf^wg 67jP JaHOf4?ec$* Js2ddU szslWgs=HFvH0 ~B p;3H""AIxR/'g{L" &!w "(xy&8º\ls$NҌ&X$qŷѠ(nˑ*ҟfLpK7,'{d GbA}i_Iur揶S~K RIў2;KJb=7j06ﮚRWa,x{/_V6YHf`k yBŁ6ܮ Y ڗD<˗N-\˓>`.2j(& ҶTy f8vɹJQ 9i"6>TLjD%Daa{\5+*Q,{w%'=1LA m^FUU6*0ket8O)Q*;fZ1E7ѥ>$ߧE2Njʡհ޻x]^s 5Ce%48󕄡ÛHDni} {}wwucu0:v ABs,FDp J-"JgݵzPS].s͚tTuYKE]3u v6pu:)P݇7}nٽq/yY{5_&TkHl~p( f;; 7gHT-9\`wRߑʡ2 W>.^ŕJ&.O(qҞn#ܴfW^t-2ǿLu _䁃 9lQM)]Zlr@$(#1[d^S@'gÿz,y٢3~l}G{й˶hVٗR'sDm~];OAcaɕ,nK&>ʎ{IEJ")9{p9Ae?T\]Yxk)p@W(EP!ֽn̻~)w!C^'i)x-yK/ŗ8⿏%0oyS(燥uQYMZG 㖪HPu"u֦@cXL?wK-gV:)So#>d<;񵊰˯M9TƓT_\)*LǖZ/`s,ۂE'paWA< ЈEbxa돝suUgO>GW?;F{ؒ|$ eQ.lbE{We 6Q6&*A$Sډ&b,uO-ҠI#ZY2B JfƎ8 V,Ij 2~,*W$1) R+iDf[ߡݘ.L݄`V"a(jBsE 럀N[p4"qgx@vMy2:(FDDU[6 :=8IzZY4B??ڤ@3X'O^ꂳ=[jʻՖLT;;XЬYY|şZCOVtv{ PEw ^VBB1/םf1M%cK'j ࿳9ݷ3j Q ct?qr9!)QB*fFctm>u!5Ý-}no7PHUd/LkI]wLY Сdh2jS{b^W&?>?]p@Ϸ&*!F( z)%d/DT/;v~)c Aˋf/@qͿ#q6=&"h|eϵ6gUM~ԍ؉0I'#R&RP<]޷o'+wyb|/x'٘ $22E\ Lln(GŸȏRro1amOπ.W?nn^#HB &9*SUrռ|Kl9xh>L6sEڣغKQlz46ys وa"X,d],@,Ճaa.2LA$}-HIDNWkied3b6m+m_ւ:==ŝ Qt 4 :W]=]raK,7ø@XpNK}vRik?Q+OCdɋ/QDJȢԼ3pSWsVoaoc⷇/'̓~IAlر!q$U8G YHQM:,Ђ2 9gFtjZaX^.5H~ЇF} J*58cnh85OUMrveHQv`RtICvi6*Hkjԙ y~(Q\t2}ê16%"Zͳ )O>#𝈦/ڽ`zZ9帩VLQě"_Ia(i TlXCK\Ɣ:Xљ7SĮde-˱V!>ʛ4o KBHZOyIm=L&̘$ASa_FtӺ޸|\+W}u)8p2. 0Zq$Xk{8d_22)3'Qźf"qj𓊚.ny?F B(K4e3s\z% ˹o=Je?hы&~hjTXRbmX©P;݋{# o9"kMYK3 )$ H)II{TOy/Gw:Y\  # ]ēG6emfKB}:|XROU̬RKJ}u:&o52m\]\}[* ݿ=h}D2Y 3e/&+?6Ľ'"XLҭ$;_'oं,47pK-d/"z2ɼ 1H_SV9r f;M>,fi`Q{`q خ)Dʠ4MH[2 ,iWJ"Lg2!wC7 ⵌ<O53X0p7dM8@{ 8}9;۵~̽\ȹؐY!6رK: =6'!H{c|Χh0HpLU ml@R/hFs/'%d&|8R9bZn&*'*zۉx=[բpk4FկlݞũŮ=b\L DJ@X@)(e(̿ z""Ub.0E8d$B#U`:AT? yŸfX\ǠkgOX8<561lVch:9Ckhx;'QMaP&}gQ`E^8X!0{*sk56X^$G $ŠLu/yvUJ hRZ(+^rz6_mڹ~Gu- ,H%.߯z;;p_շE^TFɨ_…<'Ŕt|=O阾&R]JeutZ 4B3_5<#[r!,&u }X.%%klXEF:;L|/(PZ_ZX]tjSWSgr(I-<-l6 !U[6 (] ؜_;[o_s,'u=ΩcV7~vxWYgYc99=9aqn\6(qG8[h)?C`מ>kyM<΋]x!կ /(f9nxszـʐb>kr<% C@kC 7>F֟z4H?#T+o]£ދ+ln6@04M9w/Wkln@;*s:~G ;-g[q8f7/7ߜ4q^f>[3}Siic_e96)r0/uN~|v|9Rm'.[˰r tvF1H?.c"it\˯_|+8I$8BBvUD]CP&}Q K߁{m1!+_8pc;&ӺaC(QTt^"(DϾ3e Lx'Gĭ%=MU;KM5\6?}A6%:ƺ,ԥils5ʡpљЧ |@ rދOj7~P,ک5@ۀl3$L&╇n0X$%q!x Yz"#YxV&Sbc4jXXaN~R`D>|xr^LWݶ멧Z=PToӎYGGbEঌ<&[TS./Iq)x43 ܽԦ*ݝܓ pHI"H2NW/k{g\ ';ȴl.Ry! I!r/^vf.NdeA *, jOAT?~ Mo펉UީyAz{w 7d;StmcXv<=Nbz֗F)u7W]8px\knk`V&$ IHM G?ܦW# Ef (We1?h#yC8 Bl˸HUJ ]{օ,+a(C2̓_}{BofH$0~k:{`$ ,76;, H&ѷf.:_Z'o 4Y,vRYM2ʊDE:-ocbCLRGsKFY5ZU`\ǗP÷FׁEH02H,44s]&)nWi^AccFV²CAwUBTRV_mE#3<kБdIBAecAM#jy,1j6_sbڨCbJIwfgyS@W ۶ ^P#T0U# 0˱eҥm, ^!&Uq/{w]}]Q~>I33r*oĦuJuH6T3&:`Z˦kچNn=#cxpYVuDIEz>ۺ>yAפhi]t?#s% reW FK0'B2mgAK1BumjlAha2E7Ӎ&Ss'ޣ6yz8SـgCqڄdc^sjpܪY;H4LGqRR?B%Y@&\?G9H%@3h1bFĜDprS=Oy唓=2gfn!ֹn/s7O|:ykȹIN7]7*N sMoa]ʀv3Cr;uy5LNc1!Y{96P5 D4A%%N=U1e^-63ʊtg@ì=am v{kË;m%MԴgvGAgn?jJ-z翪n WkHg"TX:g&,CI sL$Ir0sS$2ECRMõ۠ƻnGi=~y>ھ{w]ʸOZB=,t!7Q/аT} kOmOgZC2$ez߬ FAVC&~_y & / okv>1+?[@O\hu%w1{GuvUtȂ먞tP, `|5VB;c{_^ǻ6d`?\ƒJyҠ~ 65/~R *j'h{y>N=tcfT&PiTs9o|?;^z#)K J԰({K,C!irh ڒJE<{?A=B='#:T|KoװHpKE EJܫ2Jdjץ(JHJ(Jd@@M ۧՊ\Ƽsnnnhw];̎Y,(4RI AibU-r/5o5ҏ^ 2LB`KU3f q5E,*-S޾wVy|yW|z;_; JaHQB0Ld@. &J-J!C P@BP6-.|[7|{s޾jZw9w|-s|N|[jԛDŽaeEëvV #(.?j@Փ cõ95>bn]eTgND"88F|3 zR.D7vܤ9?A?l[?!,}gGEəY$nH?@<Y &Eۥ;:Ktގ-gv.u$U۬Sז.þAǤHDW<ؒ#slKJ%xa9hn:V]vTKǜ16CV=XN*MT0deҫ׮: l%Dnzs 496lr]3&: @#1D>ġlڡDϡ82]`!#@K衬@.[FB*m)ys DT-X8ik:DV9 M%o 0mrB_q\)'fL2W an"S^YKhφkfcQUKX7AN6 NFլpc٘,qnϯJfF^v,,ᬜ=q-)˜gsfe,0-U'Vsgg\?w 'x.["3( B6o ́ &+IJ.BJ!.r~ɠtEJyo_ /c lhsv\'tTr{TMB}禴/.]<z=[J"Zhn-G =]2 ʬ|9+5L/i?46z30Ý)E*cU.K> qށ[" o]|^e*X7O𘳣7*`B\|d -&!ilLF0zGVR?uYJO&j&);3fE/Z.W˵tIҗCJ9R2Wh(N$ /iƙ_j;Im |%ǜ8! 3+A[i-eP4Rk^λ9܆;}c;0KUcJ&uJK;Fx;Eݦ/ P{.6.9Sv:&մcBNu1sG8 >[/bkK<{ oGj3 HzBty9T:.HRE uwT3J⢅KUHDonþwuq; wuPΝ swn;ntN>t}{9ҽظ\읹˝ ۡH}{x(09891unoC"auLzOfuןK{<~?("Q }EP.aE\)Wvu%NaZY +ʙ  "L-NӼ>k~o/)6";R;A@ "QTjBXWk:Z, ._޴v.C $$ 6OjZH@RI$L.fh_f#g 2RVSdЦ:p²׆ōU*{$O/2K*2]6" ok]TiUmO_t d@Kg Z\lK#@GͬpvI$(vidsϛhaedGk{y_0m?fo*}z#"uCɲANJ^ѩ=db/0FKaVTH4EB.HIv%ozDM$e~ݖmX@QXy3Ҽ&{گIO-L(oϤCSoA#þ#HAKCIPJc!A ] ll#YxB@ F8cxsi3!. ABȱEVK eԇ'nn`h"  G]\ `mǏT/;v6?_to+IDZ`,^sQS5/Z1DA1 ;) 2d!)FiRFe3o{;۾$߉IMa AESkρkuwuݺl7ubdhTAQQ³cɢ>K2@*K\=_kHW{g'\$B%=-z5DB:!i_vaHaKױU(Ѹ#isl]7ʿI. (zeyT.dίصkܗUŁ-϶uu/F&W2Cr$LjѺ O,iZq,u]kA_ymR A)$)"A`0$Mt7\j&AXP<$ʧlg=u?zƗ dRB21WJjDY"hm0P2|nnϗY0v(?܇'~ONH{W%6{5{3d\\  _ߧRO Ky$DHFHg9J 4yh w(Fy n)ϣjk$ٲӲ,]~6pR-pJ[R%Z_fn/0a4 X;i_Kvz\(P@[8Acpp T7R3 z`VVVNCua]UV9 ԩ?pcyۭ\{ Ґ6Әs@II   dlI%)JM&2LH3e4,1%Dob(3|q>b ~t hoibF|cIJNsG~Fbcgɩi1?L~/_F0UV[g¢~͆g@egUlh?SI}E)DDeDx1Dɱ.$]Ԣq|{F9iE@VgHhDsL`̜)Ce$)YWxV"/C,i/IjZd)GRqR%:qb2v,Rd%O+gC/ro>4 Oxw8(8(A(|,? ( hێcy.{֬C5k9ms9Er`P"2ʽj5 !Ґ\nj+4epu{d2Zs,&f4vYhT/.HyZeĶb,07x:X?_HAܥuJx聑D/;ARQ*PB`}8x\2D骪ԐϬH2@8Q}ZRU::v?@OIC?aD@h@QH G~r8!>t$=L_;r7QڲZҶ搱ݧϧs__=_w[dhi:qg6'v)IOy.kY=15iFusIEv<}~?oz;o컕>OInRUhQdGA!! дD=@O=کl)ёП#k;X-~e4V?G*oÀ62.zJBrw(I6հtæOkR-  ;ș\ŇmTfOٿ:wdY\:5)YThJӁթXY1mx.9^ԿKu!}6c[aBv f/>]3]4J?l>k@廙&uS+Nt(nWm 7t%Gy6Do.H1%^ﱁr'ۭoOf280`98̒ ~S#W\$S&br]F}ݪG7Pެ^bj[+KdCN,ljv^"TaXqTnA$Ѫ7Yr~9,v슆Y\݂&$Zi5CܽLR;%kqdvޝ_~fץMc UmߙjkH/E[@LhN.Zqd_2!p.\G* fθf\7n_`+q &ӑ1r\T_Oy`ǂ$6m<0漃Q|K[ Kz:f)3v96 4c^fFԍ0 ׭Y;rߩh Htɜ&)0F6/>⮓q@Y a{O2<3Gmޖ B⩆NVG%enyB%OU_鼡9³CK]s@YjA}crR#r˥δ>?>/paBb\I"cC%YP+ѻ:c i z^4(+>rɋg":`>όބFőMngGՋ/ݎO%h@ H/ "ߛ ?mp5^KZş{(IE fggBI |?DZ]ö7=gVScn4bEz[aƳA0,I8 3ƕYU'Юn4k^?]o2< IH00';x; E)g ճXn & ebnf݌ިo=W%I7#`WO9ڛȢ :VP{YNk{/ %3_cdވKUGiE",H#6_?~~/8lܚTD\[E_ƕB Tw c 71IVǫ[0Q@E&hD ^~ׯ#\7^7o!%@QEBU$SM]nˮu]uWuݮۻ]tœvmdnSudv\Nnݺv$cCVEh;+Ƨp\|UۢY>f~6 ݪԂD j;p1y|uel/ Jync|Dd0wnA]ą}϶b5B`R: M=oHN,@'xm0%-THF(#z)A [e)cT y`7l cp_0΃x|cabߧX#Ȝ  Ny38}蝩'ReiXO>xe7H>He]ݿv[N+d8B@^?ۢc嗟;{#Go8x둨lPM 9tӬ8itn-PwG29&soW~$l(< ^NafC1}MSc ϏbI5@~6$$ńwuBO@^w=r>eQkaVp`BI@$QhB#NZ_{vJ#t3>OP緳"qVLR )$tuN}`!3фLY1@ HC/`I,[ -4 ( *$vg6es t”L>_pl/4뛠[:E,i$]7L9H=¨220Qs̱M8eD 2b+A=[[@v$M,i8Fsm!,0 1=.@P(^~]? )TjlJMaRPE;F2IB4~P#Vm9%@g#;%}Fm ZO- 'HI4%+)‡f- J̆ AR8,PpUi{!`Ҏ20Kɳ"4Tb@DAp˼GfT@EiCPDYԲ9'Hb& !(B[׉\ͪbh^sް FV!/>HT27]6.a*Q 8 tkzJ)"ՒA{Nίi_&oh'}/ugWws֮ ݠwyv DV .jS@M5UU,40u^ݒ6WZ򾥌Fy`>jJYP+Gy'4cP}7힦p!tM«]Hz}ގo*=)x|ڜ'5!uq:~$\ 6S9[bz^ڴ3_FV'o7…&<% uV? ᛴx 52A=;ߣ;󐞲Fr5jP8QUt:N8'9 Qn5z0,4Jnŧ) 8NҤ4FQP?aD6>Np#x^"\G{U w_b#{stboo[-+Ɉ~v `2fݤqNQ:^npKsARQ. E\ @Pfwis ~Q;)R)PYq\G ]qAwLT7(Z'k<^?;S϶{K9l5f{Һ* wq~׋M?.eGԝe* D2ǒ'kR)I$|p |d2L?F>e} 1AOd;5@2fgB`&C1ɇt@d{X0(@w1S׷}YtYhl;uk 1YίlрvDPHa4,W1H> - 0B PFqc`Q+`םm3+< v!)5$zOˍ]Qˁ6ݫ˼:#:y˄@)Z b4 +#&i {'-$_D-@@]m}`ИWDZ R23-cE2B%!XJGR߫fw4w6 $HDss޾PBrd @~Pf9O<-H,?Ҝ1w,Tc<~S<\)i7) فBK5鮯^C U' G@-fMc z*9Zs ռR,+^>C8F\Pw 본Kf`;/6+sH0aG~k~kg *`XzH$"AXkiWz_}{^]]_7޺|KӥvuxPOv+{U=6Zq>¸gťqY9Ѓ%)n쾫OI?N׏vҾ{y H@E9a$,:^=A@AjP "T=*R#!Vλ0HT!*Iگ4ZݮWkJ'S0 a# K BT( a#$0*LKx%BQy KAAPдX X%IV.\J(&b` J H  6=zu/AF@`HP32Ap^7{ŻwWvF7wyB.M 4:<(0 E`sk*s'y1mD6Mi699A0s"T4 bj/|&?)mn[ HE$O}e43Puo|wJ8:][:u]'z/Wc z-!TBCst>! 7m nI$7 I; 2cCj%9A~, 7RfץnHXd45ζpg888ES-~+iHGq *~G(" cReKrNl2 J tY Bpg"2Aph".&w%% y{Q}ӧa~wxoayxj L8d!S J-J(^X5;d]0-gB "V(5Uoϡ,JCcdB$i1@u0R4r-W.emL/ *W3OƧ">Lj=[^7O+nq|>Xq:$/Lip{,MɊe_;I}LG|E^t68@In>q4lӮ'R\c\!"nn! mbujq'eN~pw ǹOm'f̭ºvMʞV͈'%JmtS? Q?ɴZ}ӏx1^yU?yHC~Ӧ#h#vONtt| kӫ,>a5nu9yS"˰#z5O|H_$E}zߪ71]3HɓeiuPybx?7]6vh,x^DmHa#al@o@#Z~(PWWfK JZԈhO25oITVŇ=G׭s֬F@h0N^&Ni?|:&bTTA0tֶBuUu"(UY=.HCvzx\:ь+WLq~ʬi7|(f 6M%RMzK'KО縁tP#uE eѻgXQF_9e5/yP[,]z:Ig?H1:mGdؐUuԇD~ʋaw0'KNqt;m1N`Mmu#t`Fo8gs- :PHNXo1Gu\H02j:{l%mTXH3թI?Ġ ",ˊqtVn?ܩ{4#_t $ys~MF_{u&JĵY:MR zϊ UW:TuQk/7cyܫ?G Tp$["+kCTze{_Ne_iñ綕E>/ GT"8Q!is!HRd䔛ft+U*r-< 8ʑ/mh,5uv_u>{'si>r {|_Ќjɴ L&jub^2axVYe9pe&K,L+x-A[KK*NYS5RwQărZeEp^r)m zvM 8MYcQIJ݋ٜkɈKix=Q8 qZ$OmYphN/t{K>kA2OL,MY zjٳ*h͂=;'Wõk| v+¨BӆG`{xTٳqŬ~G7tf;մeUћy%;AiM)2*l͟ut((o9Lgշ?+ot+/.~=p` ya aXQ O}B$& BE /JƆHi^EV"D'O3}i |3i V#;0tRPlxMۡ"lzg6G6Gn[/u`l 9>2!DXHO͢@Mzfvmz9܏k*bs/Yin*envWWYfjݺR,b,&""azrW'ӫF.gFk6g_XK:7eUNѭsNFMMwf^6]/[zng'GqUy-K;N#%b]e7; Kf+;v?ݵZ~o?nĽ.fo=y)`~3u}&w^&` E+\~b|yF#_wu(e~ϣ~50%i|D+v?~C~_;E?RsĚ,o75_\V+5nH~^~u_|:yOsN/(ymbrk>}{7%|NoZy+h݀xĹ=3Ikgyo}^Ef|ž\Uz z𨉉p]*S7ru"jɀ:EWL5*bFDC.jX\@|;W{_;V/9ʞttA25Q۱Tb4v ۜ CrT(_ٺ:rrcy3q}e*!O؋"5nOaKN)8]#VߕFbKQj͆iKvQObt̿2) 5! ,3xՎf+i--Jf=Ƭt%K*GQo1S2&FV9xtpjӢX" pӦR/C>bL>8cӀV9N zFkWH)g/ 6:Y>jf<ߺL1iY|Nh楹˦Euꯓ?ͦBIvxW;O}gKx6M@pIf6t-jjފ;Fv4̺" 9K^PmoՎP=坼oeҪyǨqIoyѻfu ޶/up/DL8\7[Da Vjs[9j?p|ح,o{RE,9S]WMHy k6z>_]7aߴq/G~-=>;?E[33_-4yMt{z&݈*N餥9LF|),zb%ODD5THi*:ZGyI'UtuUa!X?ֱ)2gZUPq5|yYf) 4U1.+)UOmSuDq;2dŨƵyWVI놯C5*V#uNqs$-2i&(DaGfK3}+Zšފ0Ex&EcW)k 9YT7Ddop㢉-|Rlxk!*l/~T;M[z<̈́ΩAȃYO&:?J.0'%{+v~Mz-e vFc:vXLPy.;.*J8Hg7L ʻǐߜh[*4ZX ?yP]f\ؚxUm%x{D5/0`ε/(mA^!9 3B-܋٬ODef']RbSUE ?RPMྜྷ͎r+? |mdTjum&ſHdd{zY[ʵ[|yfOy[xkt~}ci[tl=ɎFx=)6+xs7);jc%fٛML@#mQ -6Ix>BtaWXXAO#TLQ"Yh~}I($& 2~G͘)@eE{e6ReCs![m %#ǞvW:~OR{m:NU٫N Ǫ*.J<j!$Ʒ6ڵܞAs3sݻ;g߷Y}{-owۙoK\;Xx+-CcEX|'H Dc~4+ic_@ƞ;=xP Mh܇:ö}Lf'VQc_+UVw /o`c|s."򶳐ٵ-9Ux>/ /=[u~c<\o_ΰ9x\~鵰eP{5̝3ꖉ_oj;4<8\*w14޳k7Gc5IWw5r=[ڣCR.{&?F)纣i>N>M,~ M L<] +BqoאQCK-BђS6L)5X*CH!H" ^7E;TOϋ ~}{Rl\M:lWSy^g"nX%rG'4̩,<=TxxTnPw(2j!b.= =<5V)QπYAekG71 p[\يn/  ]l#JW))}:6eoaPu~:hh蚗Z)T{GӢ]{u'1j`JՌ ƶ)`0KX1y kRȖ|1kϳysWao ̿CO8#9h8ZqaprؖRU[=5L~+ abE2u*f%Z \̺)BA=_^켭=}(v4my xѺn}CFOz CLGA3Ba)cOP@mg'oAxz% \ɶzGxTi3YcIJ}אzZgja'3"rj;d9͋+ T.jx[up]7ӺFo߽`i@7-7E=,yɊJ ;'ͦ-%Xn`Fn%1[x>eD>f&m/#%=K~g`z2={0tܫ'9wxI/k?oEx%+ ld|b\yܞѧ-z "H E$ 4k?̿#?w?+r4(Z1b"lf FikWmwW9htH4?絥{y;$V?y @1Rh{7w+Wsdgx~=a_ B-n^׏Hkv;Ϧ{_Nx=MW)z i5vOWk__}9wvÑw[N>3%qf9N_(QMlyo^KZBaa}W!ta=Y;G58_o{lpx~6sr^|)wCzwqMϧmd7 sP?ȵ9E+$TK ɿؿ8 %dsyֱ*BUx˟0gĽpE1m2h1v(Ads}{.jŐ]0Bd(2R>NN٣ ,F=gu6ZҙNBp}"M&nqx-4_&߿wX$jWU0A0Q1EfM\\ny_P .=)rЧPM㯪)r#- fӵY52PepZq&T\(ѺA>. w]zlq^4;dHbxJ{cr.O" `N&1Mm[ Y.]+PF'QII+"h81^M~$]--='8V3CN#;TG ;ok !-/CSNMU)[;l樐"Smѹ]{uc:6.H+lM!G>0K! $#`o)ѡ)~@Qbm}"ILW}&|J*&{x;rs'R7߮q!+BZ-.֎׵7DpF5\mt{GS"NGA4ie)fsSR kqxGx͉׆C#Df@8PMns/%7M PD_Y+|~>@&:Wd]qtߑ9goSq$N5r^}׌~}~󫠯d#DXd'qN]=ޣ?P_}ݙb}|] >#qV~K_4wOw8n;IҙG!y<AN-!cHr}],OzG/p*d@ 2;TAN ?*X+~ =j:‚G_F@Sb CSq>mCB7G.@PP?{~G?{6<?F" "B_Shb'¤O;_qmqVCMU D( DH+cQsz/LF  17>j4PUh{,4&(hh>]w\"r߲W}c%B1dԛlE2d׾PY=zI&pמ|?෌xEnK#*~>Tts/31cG'g bP _tH hxVtυ#4Jǐ>i|m'=-wEle S@.UORIHYy8"w3h.r"1b"pDwvG1vQV$ U1w@ ܁OEW}p t'ewH ]~+!Qn(xԠsH*=5^J¸Uzxq~^g]xj(~^7{F}5Ⱦ_mT@-•֨rnG%Fc^3>GM#ytw8ڿYL:W]vu,r2&HÙOzE!f?hџ~HXv958\б ݋259̘0;/?_aAlۭY[վ~~ٳ%Zi׷뼺'67a[RRڒ*l'!pI"d"\.bغpQ0-|! [F I-0ƆĪ1{`| aTɎCP&,ZIAj &Ed5Gn_"} ϖkBJr)ʒ /i*~ɳ&-J2$jloLD&9^w?ˠ._ʒ^m*"|h89|;&Ve0Yh.oz2.<ӒF1R2 Be*F1Y K)YI7[*P@G>g2[],ژd{^Y&k*8+O~3|M%Qb C+ʐYE%T<\\lC6vFi%UH FJbw6J1*62cc9$Yl@ƺZ9W)5\4ZZUۯ{=nب9tL-t)K=*쇾 lG*nz ŋɷڸ[m9hdZ"Yv 9ic5)cMis_a`tPmo$mEuB"EXIC%m{]7NuxYXkʹU͹]5 ncAA 6ZKlhkc]kksVTUshmU\ܱݹ%߲byniF֞Eh-1QPGѢ ,M5Z0lmS226{Qck$5*j X ; %L 3 #Йq$=YȂi kh7_i:0 %<6,c<}<⠩>.^ܱK )?%IDwpwGW >Ù`wg;rOxnnujȫ+%7|_͊kx>V(%0c#uĕ4!vYO;)TBXJT`!Ϧ-9Z0fxpᏅ7~ j]cq2hA<0+s# ޳)8)PBj߱aT% _^U \ 奵,HF-dܶ";l:y)@P,7#1D,SUCC[q)c+3jz= U0$P1QZnϷv|h "H߿m~V\PHbTsvb-̴rn48U _4 C E y USHr4hM@ iTu#l֊ )"95-Qtʄb( X7Α^eôvxaAEUq&á8Qz%eV7 Dl4%(?l ϐ,ZIY4]Ņ%4ci'roʕw!"v -*ԲgEthaZa4`a=[Uh?8K5@5WiKm0ƘKVT}*W.Ibͨ什%su䌃2%9Z/2YQ|l-k6> *ꊍѯm˚ U*LeiBESJLkdCd#( 5 7Ă !ypb $XZ)BO $ l`^T /x6.WN0iϛ ` z" "kJ)iXW+^΍?CZrsU(3?ﭘWV)ERbUfh{1v^=jyp ! $PujUcσNj| `-.5l$! X38<eU\k d"ngFB@|M_7 S><(.  &@eN~$d E33AEO枅hKުgǝ2ʩ`E'c?wx`U()HYA4RY#HV?asnz\5qإIJJ*CUgfqt#Fi$dbUﻵmR Al@D JXngA}^Urau_uE\k?jLR":jGjؽ 0]ZY!ec B,2Rj%ofлO:-n_ozw{íwsS'NV~u?@̃h@F Jaųk(`wo\NN?ϼ ϕqkyU徽]z*00}XL ?/b  )UAnDL1 ```R(H_N0Ȓb9lkKGi (ޢ!U~W=$Sy& ڨP[ԤDTx00¯ʸbLjOP~F9k?vh^aϸЭp %󬌰a-0\B@DVH'Qf|~kH=Š0OZG6xH\ $ r9F]),f=1 WwQ9 * BKM Ď0 E&V-TW.?ǮЁ=[ 4x;~7S+P&~a*m4l^&3[! Y(ZКqł F㧗dPg&YnQ9jZpcŮD b,ꑬW'B#+T)5هoɁD^eʠ'C77|$29p!mH鑩F<^T0VFMD 2bY-A@CB4zxǘϟ<,eåo+<؛TvhNvj_K ,]7pXB P6YgcbD-DLc_P.!TƁh%j!TNEQxVà@7so1bɳ,`hܝ9b@)EU&8n%:bC?9kGaлG JőUR]=L cc$ ,/&H3=Ӗ4g@#JtgFʳKkO2t&'A\Aaanp3` O;wLLb\/BrC0V\ޯmivotk۸iƒ@Nn/ `9% ꘭!Se W7R2z8 T |1о@oѰQ9iȝD34Ov bAbfxpw|8_!nXB'„궉f4`N$A;x"`Xtysb)*#jFCM:t2iYEY36\j6q!!NHV"vzߪ]8Lp&OBx5c.9YK-v?|-GF\F1!)Ќg/#\{[IO$ ;N=8H*Ѿ_IV][d/K<5(#C _3n9S/2 !Rʹ0Ҧa-=eBèT]_5Nw.>Ft /<`s\> oy5/1M@W2~{R>9 0'Q>Y{ޢo]~;xfk\n^o!)[|owWKƼ^n꒍z%K eBok͢:W?%omʺyoѷ:WDޞr +{ΰ~'L~w^C_{WG#2a h"۾{Eic|so1Ej{=Kۖ7ܤmk]uھ]4#UjeKh^k]L\_/v|{5"ezK]wuėu޽Nn%{7HɚQ6{ڶbJF`ꬎL*q6n,ME M>QNRM 6M{$&+GUwhWnwYn׽v殳^pMnS7[u1+%q/&veWFve|'wb3}w/Zy+&I/Hh™# wZ>R:밣h4wژ]f*65a/[i5IR6knɶ|}u4̉Ժ!{bDɩLd`VS .ZkIaR6~x^Io=LQʢ&^wSwT噭ewTmh"WF!ٹJxB <#W{oUZa_PHKhn CˋR )s~CodSL9kРPӝ5_y闽?ћw>Vvdvo1Cx>732G:"42t(˃x ٩8e"(HQEy\gOµ"Jfu PPLU VDRþy .T6|R F4u~FzgZN-(z>d'*g| EjCXkt(Y׮aYJ)TZS ~ijOԜ1%U]]=ɗRL6%uMb0!o27FcK\= Tmj;;_HGb/4#/vD&_I KKJNb= ƴ9f6zdI8vF%:2C$% Pcb1ׅVƎ͚ABXp z.h8Gv3$o%";Z11jO>nfi qSk]'(Vڃ#_Ϟc}/\NUIVwS-Bl8(:ә]Ʋ)&M2 %NT&6W@ t^ĥ~: .R:q^Ʋ؆G{EVE*3޶LK|V`BLHÑwWQەY~ $wA/iCi55x&6x8FZ+gW%9eYp{ ae?]Jۑ,̒@W GPAf@9qw WGtx.l7rJf[Y0.&0w!bR#m쮃>*+OfDM W,EkWg>?pc=#d z F9%URrvͪ_ ܒMH{PhSHc{bJϜ/}FLǕ2GLK70_ed/P (u1v G`};eD(Y~wysm2fB)l ,1%vcm{S$ܜ=P0O,WO^fIYFhDtϋ@" rca'ͷ錁9PE/BN4hj1 _YHFu(LRssi0=7@wʌ&pJ]͉1 ܦxJ!XS͟_WYY_xM>rtzk$wIES}8;z~FMh/ puf$M=6pf]D-[iIXS*9.ȀY@pY, ~e|ḋCرIǾ"›/@]OrōªLvz1{0" G{`A22jPmM|e̒^ՁtZ> G?A_6V_ !@~~QM<S[ tTDQ.XOOb>tIS).\e0KD9߭l 7́<:6'҄5q`߯Z :Cc./Sԙ; cA(.Sh!\@ywU޽a'ѧ:~ i[)}Q5]JVs/Q`ՒֽK ҆t@ƪ^9d4k$e"zRйA(GNRi|x#Wb.Tg4[$}΁#Ê"Ç]a2`oQN Ny2Rpiֿoq*)|/_]'a2bh.,@{†sG"T躧$}C,~Esrk7fl ;+ct-?hGd/!+)}> 8drLħl?dy-&H_ml:oyzKDܦyK\c f;Gk~5'3(xIPΐyq+Hπ8zUnɇ=\I3(,.2/e)W@UP1 3ŌB$K!K88cxÙC7ƢeB )|fӧ=ɯ6LHB_!b8LJSi #sX0?&6E=1*9 q}Ul/vHfUl%XQn,|FL0tz}7`/{FT:wC]h jRp?gc&}NκN$ց-YIEȜPrÿwg%Y+QV|g D< E¥!u3Y,:MRv࿔ui|C>C1Ctggpsȷ$ ]oέ.pnv:^6SRk`ZpoT=ԉ{amj85Aɡ&yL  fOtrST~ѾUd[DFMf8B~nwp-[g$+x8e^V\6m&+t1doRAjzsaƜOr49G0Y6'DxQjt&r."醈]d~ʛd VAl gN5ŶUHSF^yގc8 oNӭ[yh=7BXpN'hFǕpkZ9 lYasٴ%vuRŮXQӀE{5+PvYE~>͵ڎ8 ÿQ N}*ϺM]R8g|)ȗ %9aMVyEjddpthZpsje%Me ^s1"qnL+aD ,*W'@:ic_<=wfkF3)Q9˫9brcBdّ+7GT = _9 gʥ<ڥLɽ?B^|3b%Q D(rrצ0P sƦ%ktk0dրpq--Ok>pүxį!L6|g ڒZ#,&l |Z,~8h:N %(aN>G#@w̧1IDT&U?-9E2 j]Srɛ*J|W|7|"lp}Xf60*>i&3U,z!|"|7ۭlI]Pz^:Bl@%|qXC(%Cb8W,MJ)|*|p/&&gڲ:L gnjDv$M>]Q=^tǜ9SzZS Uǵ%gRb/9|NE{,b6ٗ>j/ NL2 #b0D$?|µ+A|ކ\9Wߎ7&\4kFW5D|syd?&F|/THxZ7;}/VR 'N]ySkk5o~QNn%DStR%>2x3VŅ$jC-(/T{jلy򛢎u(P#صն]^||U)EPdg,l}y3]!%h7Bmތ g&sp/f͌ zYܠ{6r(gUvߏ:V㪚biHjW=|FVW q|El4RX$y&iRa8 e?{|{|y||CgG~|[Dgk@UR 8l|OU ʗ+|a8JY|H,$^m4UeifJ >"j4|Rf؅z!X]B&6Kaê$g jj1=._gu-W ] u |fy^!AS}fLJ&C~qLlzBAe|'6&wZ$`|?r?n rw6 d1qF4e3#kP3uH@{jVjЪJ3s sE oFT l}?K6a0|ޮ^./#d"oN$|;B*v*$%9DkHnoBkr^xUK:w-&܃v}ǖ7H:zLV<- id/{.Ak1yzzэ>%;S`K}RSL|٤7:+:ʡr&N|pIr'/\9 QBސ z!GhS&zl~"LMD~F?vWjMi*ޗ"Xׅωi# =[2cnjR%I=0mqw!iM[WIgMbh¿ɎETl|2>ܫ67LMHxo*r|f۫`_p/ N7}j6|cXwψm.b|vZz|a=V S;`$Bh63 . _*$ Yp0& |m}dk]|y3 A"_Yx]~[GZVPg~e|_|9,Gp%YMvfc&|o\|w7s2naB Ib>|.kYxAPuh$IjCUq}MVL?e9P&-ԅu{]WKQg Euv8Ddy[3jZ|s0YFgiXl*}_[0g#h9J2:.7?ηvg--LJ4_ `Y֥`joe6J/1}*| L"0~lݨS ^H.l+W޲0M.|Zn!:!b0оR}:Ě,X%YoeّSFT4|6,8`8n  Ҫ0k}!T{qhWrugGt|oH+Ru|:AqГh)xN(!KRkSw|3ken :Y>0e&<9z|{=o{|?&G~|tʉq|;NܑoՆK۝Pۧ/((*'#vlqPZl<Ѿ̍|xj3c,6Ż@8(A=_ju[2DCxw0e_wF6UVc(j!ƕ|=,p.b8oIK :e;@%"P!r|Gz׺)5Ɠ|%+9[d5f0kRbƖ׵@zGT_2|@X7x?~cy:I۰Uq>y||l(8n:*|#š^tĕa99(R _.WIeQhXkJ" _6taJN"ρ`qA$p`k염rفe|8/:/W7}bxLKW7M_%nh;W%C5mtmƋLT cDvé#mEs> j|tn.| ¡m,<%1g|$|H_Z!P9~l8ܤɛ>z]Ř),?|}y̷yYI!TNx | &V_~鈌%s|%Y|d6:|t"w>]2Kq^IzȞC*|ѳjQ$; z24J "L( @tɽ=w|ph+*$ڤƙoǮoŃ#E']z$22|^'3a斴ܳm[3\qGScLC"Qxrd~@`? ?C˜0Ac~U] '+B^38}Jv;CeY*p{? j|㦉reRH$Wf A+x 0 %͘rhQP9ߗ1cZ||dw?Iw)fYޤzє:9Xd5@o*=E)Z*Qz XPS |{k;S_mAz8rfz]5&?4 ꘺ȑ}yQa/PU(vI(ZF)^뎄l:&<ڒiGR R>LD&+RbؔbhlBl+䡪E7YHbȼQꎣ,~\Zbf EaFQcJ@fi?A 6ZGJ4g&Mz24g&SyLL?6g&1E79(ltS&=OhnoU%XHXoU%TaNwtAZ{9ϐa]%+c)+z6[0Y{k;=%,uj1Wn1fz!_)CMj!Zԩ`N$/^M ݫJRll ٵa;>qzȠ-\7ꓴݪ(qh }OӁKzЁ~N?{Ul&3DӨSRn$頿 %9׆_nt@\Tk{b6tŰ=UvRF9>1Tb2j+Pl"c㺔lb rlqߗH}~VBE׼9 p@?Xį @Z=ѣ9,ca]UdEjz #_8s;\bd[ѫCm!0;7"6Xh$!ՌC-$l*x&sJ\xBN6|e C >k±h|1$XI#s{rJ2Bk:(+p6yJ2!͖}Wdp=Ӷȁ&al佌ܝDł\:t33HQP1-jcoHԵmSWJ*{Ily X,cXЛbeJ]cǖ"ղB=@f(` T9tFrɘҗ1վ+tdW+al#eb@3N`+1nu*vH.)N|M]:9I B>/4,*"6X$$s]X oė ³5faVĀqO(rgn't观[ymyь G/…Bظ3{us7mG<攖/ c`/6mh|j&_EްVv=JCpq(M\f|"[zƄΊwwh[R?Tъ"s9<b"Tyy8| 'V6^ī$:7gW&v*G<34q;N߅f+U3D=L0M-e87c8OM ֘QgKቖҬnOSO_/k~]1XN|v'肾SFr"qP}hh@C&7Uɀ/5Wq!7ypam ;V R@󏂃lB7aֽ"4:\`T̡oE!AHi/0n?qLpx(ߠ׌4Q}}+$J+99whi]һ:MzjBuZ qjʸ&+=:5XyL;!"uN(1|:G\vbHyR`#iZ4]E KAJ1l}6;md -jX=X,ң +%eiem q9f/} pB C ؋t^iDdDP ZuAxF{k/Z2Da:_8QdZ/E7L96CIw0 ~1{%yJg:%@ңɟu_q3]dA!~!.v4@pb*^آK} nKIJ%i瞂-,i\&;tP(ig]սVwևņ8#CW;FJ e|6 ۺ;sHl|rVc9f*R?SEMߣo OE+~CJ< B}^xߩdۢ1v͕xߔ4+w g!ODչT{\&&JOAfş+>xצRňv(y"b!#jbW,C!zl+-e\n}$qx9]ɸ'~m$;{‚KU o"43g^y kT\mo6KZ+WXTŧ :\Q!x/ŸV^pE|+zz9תhthb kI+3Eܷt|s3V{cAy[ j3\*nHf\K o{WyȲpz9&TG\ "[$EWѽ+z5J%iIYzP4&%ma!ɓh϶}HM[O|wtSQqz }˥K&K*9k1Tșo_6SٶmPg+B iX%>,E7j`̯kľJuMg=(r;>.%Er F}fo3vW&+"K= ų3(bi﫯Ǜ KO`Z&P=l8ыT  W!w'Ӻ\r$vOkƩ.Ч#w_?D{uRSk~4*"=mP;c` upQu͌7L=͸p;VGA;pp7#4f.~9FVzP'̓CƄ w70=K}6;FSscoO:uM35rMtD}5ѐGHmٸ oƪ?kLUUu˯*ơP4koP O!WV`}Mո #oOsŹH␠= ,!LZAIE >]"EV* V  Emon5:/t)Vf/h&,AC,TKMݶ< P:}y+ ΞQ:-Uջnܝn{7F#qj#ҲHQ$hKB&&]gK_G*r;|&#?ͤp&kGPᙱlRV>úA@xןws_L Q}A&AJ0eaQmO 69T(HX eQ2!n.;BdA.Kݠ *)vUͯZ{)%_ Cg]댗F.5 z HМǁ(Adm<6z f-q[^2)&llog]ՏkT< xoK+9@~f=d !{8k 7pRV"iF2]:SwzwjƦ \:g4ư`=EaDt𢵜ܢMESM< ک!}+@Ƣ A8Wv *J$ythvRͰt0Rm{U/([:fwM10{bl]z$XYZꙡ/D4FPy4+cOyB2I}x;Mew 8쨰"UF.B'U<>[^ e)xV2`lJl}P1$N&6G @|ddl'bns.1=|[%"dZ6ڰ`9lj],[k'C`LpRєj-EL.ۻVc_%Xͯ !&b:93t:O\2}x^OQ8oy>u5mk>g`&DV)! CoS& 1.@˶o"cSJoC.&j;Pf\kx \ U_c_x\{;y^ ~GNĝkר+ jPڧ/Zo|B&8gF eaN֎88ߕ-lWlU#$d%i籕_?cjM F.H@.FfHմ$.yg=m8XՈ( ;mɎ$e!قk)r%)mY(e'@ȝ z}x'~Wv_]T0PVƔ?ՏDV!H+.lY'o%aWzF&q< uυ0_Q IiNͲ^.Pî }8;c%7__o#H<}&cg)T^,M`\ oݶ#24h(4@c>dbz}/k  s|zEľU8 EjYxԘb&)ؾ{(5ԃfjvXNY紾4[8T|ywvLO6˜Р1k2#+gؑml'h0-y 2c_v\>sm ZH;\) Zn g\0R7#[5.@Z iFoz$g?}ĉj8KteM |&Rki lG(ݓ0>9F _yR.qٹxˤ~Zz|yNf CZg)(f 8F^k5(l:\<@L8M>n Nfj/ȇ25sI *&#Άؕ /hqQ'sf*svB2U{ у?SJς; G2̊?qn8vR8l瞉g 1[ԮE!3*WgdU󆸧W.$ReY?1D[^ߟ  1@V=t?yՕҿ 8䭭IlEk'Z$ȶino)%SqCYF}sX,2{$лĤ.e1yQ, ˩P^+$Z$Y3rU~z0P:tenPr@,qT,"*"tn/ M--+D) ȱIJeFr=M|lgXzH{Ovw)/mNtN}w8yũ uVjNw 8=}Ңb3ƿLZ De6ih=NO/-˧H].oĠ z;' jb9cuؾv/ YWd-v0&\DV@oBBG8t-#4} 㖑:SdH oqam0d_,cH.iL^ȕKYCo]зg߹姵N̔~ʼZFX3a vF/oeڷ ۳k0;wlB B :}tDΛ`CnE,7N\F/zDXn)zhh˄EP GfrK+h،ݹݠ&{ 4t!C=>Y\iX\!.En"H э4!XQ1vTk`oDLJ{㪠m-VZSnUsb#ngZRL\2i#Z^ VEgE߁gC滞^}̹)"+|pS)Rksyxu6k(񝫏v9eMd8ThQr 0RQh5Bp"̕>w`cs&g^56k,<01/O]/ljaH=­p4@'q獰fm5"|W܀=P@1t G |JAI>oI[,ÏZXoѲ/q(P,R{+Lp!`P}>fdTX,1%>UMl ff`^pܘe~{~W`0l (csh)?Rm򴇖hO|u:볋~Cڈ9q[+S8nj.⡖Al/%'C:,=ԤҸ׳j!h[3^q\:2B|U9aޙ&ƴm5HwloRKG_o5 d;;|V@@':ӂɼGY6ͰNYIG`x92ݢ4l`@={j}eI iPΊ WL4cRƐӻz0sn͇Z4ȯ%$Bet 䊽:6  Euc]}NHH(<퉉g‡"(x2JN Z(I16lL;p& #2A<[14|~ ?oI5QrpCphh3^<\NYdvF-kuSzM6)%`matOi*ˊt`}seVz3"j/bRI%4>|$Ծ0`*/^b3,΃enm!cj=܄Wh(#A4KBc9o> `^ł9,dX.)#MKІR 6ȍ< s1.cG)86CkS(a}" RϩhăO#=7vWE[m;YAnN b~}`/3P˞G({Ѡ.f 4"N1l-!1KYeO@լfjy0E섥y)Z yKuL'BDZpRv1K7ZfI tqFLeOS `g[fWiw0t+h%Hl:C{/4C:]1h=ߴ[DVޒu oaXsE :BGloYL}ؑc uS߸UL !:m#E]8mO-FWâ/Dܮv?v$"A 0E@,:ٺg fmeULw $jxi񝸪/t*@:tx6wĿ)ޘ{\o *̮Fm|~&.1&=Z 8X>s(%9*P$< /! eg:Q[5~ES (asqTD`'u6%eg>2"hƞ]8PF^ ٻ`p^7TCB ayXˎ =Қn,Oҷcee, 2 )~eKZhn!E"m_JZ$daO=fbx/YNWh+#g¾^Hv>*osQvSK£9lP`Z2[|.-\9QG9 h,(`EgT"$vgk#EAiyK{{+ 5qHCUO!.{Q0b_`*PW s| Vm96xU'[wet`u9 ~!7юt0/t L>64C 9Eg)vzmOjGs+=gsގHzH`,8+)ʞΖg[)[mS60t9D7sS*e`DvOW%P>H|uPzsK^}|\S#b Bw+Ȱ= FaeR2N\4_LY$in9iΒQN+^h_*q2hʈ R`j '?uM[kk)] p ӯj!cNI8{5֌„@ ?mظq*5--IOd rn?ɸq= FjS`TMy-Vq 51HlI 8Pi;X*T7ebQ6< TV CT l"<ŪPX‰ }-n9s7kHE&:Ŝsإ( d cY/l"%^;x"S8:aQ9<Ȑۋ[ӕdC!%!jbT ХFt{׆FR'vrdweQ W)^*z YQ2_X@DY\D@VW(f BΦuǞs^6 x^) H+/#x6ajt;;BCf߬ъL/IIVGyr ""ߜK_}' @g]}<{TʆڕB]Zia:ѢR _>n]'Q}{ݩ ?AR(+X-TT;0p2ƙL~mP9`@fԔ ԇDu+Xp':V7o$xY|z.޲ 㦯%6컫1ѳbQ=.z扈y:[#ꕡ i, Z2v$jXi 䘕@߂fU0XH<&w5Չ} mN`q}{8\UP4P:@ gXꐴ;Ĉf=Q;v|V~eM`5%Σl(Ʌ]cB-#2.wTp2G'GMV+V0gaE𱡗 Җ8!E3]&?ˉeaf(K᤯15hjK<&ٷ$_HbvSރa," ׊e^aH+[r.`рya2{q<# '_Wc=_ N)JB 35]@[&5)xcKre`Ӈh5WyL)mDbX%s=ꈨ:CiXQOZ0 %ܩZo 8V+K%Ѩr&4`Oj*fe`u Om-kkf_mDt6VZӳ2wZg5|ٕSb6+ d'*^_S*wUÿX寣r11-7ps}h{_T&0lI%Drkk6W>P uwжo4[VYw&-AqTs w \3 qYG@@,Bm=-l>GJޢ-!noőnZܠPǖq~0z"}^9MjF)~BcиCę×.ȤlrUB-|ZSfDQ0|U2,HtT/`FngdajRkq6+mbJv%⪝Ng(S.QCuyҫLS/=+?xfb1kE ]Tr__/  X0n\m♞Ųk@b L}HzL@,nb86g"17j8%l*>bM\#+K3f 6vfk4oI^-Z.qE9B +_+h)LPhfq&Z]Cd ^w.S_e|ir4sя:M: uIu:p1G?Wڪmpz3DZBZ1.;kҨHʞM6+bbFy!]dP5*k ٶ-_ێT$X8޷+I~*ep=l3B/?־!cSmë-6#SK)A:1ϿLBޤ㻃^?ab>L6{)vJ٣zSl!Ǖ)D]0ԯ'O;lyz]8kM4XE߫~TlѷO Dd󛓤(4Ҷ.8 Dh-R9w -QD8*~BYP2":d2 tISW|n$=/i!FVWM 7v~&.;#Xo|oN2}(芎yN'ihtx doꑾqp^mS'jlq2F P&ӧWTGmjcM+rv3A$~sR)"b]qxg^~ON$=| r&djq/90y"Y'q qS; v$W](IN˚CWo+? {Bb|5[E߳ >k}:hT@|6BM7vbz@?Sș4,*?/7޽{p-AUl?rkw2 vD$E+4.籟z kOuXvYadx\j_]a~LjK`D]ו#S)& !.2s\h[&?\gyU.gVkd2PR?@dixYLxr"R7itdE lX!K 9/s+Lw\s/] ex{Yɧ;V#DI 2cH#$p?O&a {PJu SIY%h-u^V,)kMHU#E`#@-i5WC(nTD5!-%ܧ{Or$mcFN:JQJ)gq1A+lۇ1e+(#o„%W'vz.Y;K]uSE 5F@(lUn[@|v`2 }  ^˹FT^IH*FZ!m+ tKu?JHQ2#PwFy~J1tXHrS^ieWq<vtd<`kNs)SsSO~|zp x _#;č:\/@" x|?@х,}qPᲔ$wYQXšNEٚU*;:Z4l`Lwⵢ47=3Mqm öQӄ;_+viX5ZJOG/ARG9 $c gm4M]i<ӭ-!20Y(۠7<Ӹ AɥG5KݦQ؅T`ux[6 oɀ?n*nOK+e-I٢%#N o00h-Wż EI0y0_/82e6 .$+^=Щe]Y7O{H:WVʧ9ǾgL0d>iʢ5>l\\J?,A5yY]iZ$enEV1V&5TiuDˌy1Z*"H6Nҿ],˿य UʷwttZrXWԐ+SȲ*(p}wI /RaGtixxÀΐW|@mG۶8إ>R4vsu0_I7p냏| ]C+o ʑ X]`4ZuCU ґQ8PbɬvRe2-@ȳqnMRčo[)DѬTm\g-+,}̈́@5ê3ӈHWu@%`Yƺ VdZl /8l*ͬ"z|Fߓ+Vz oHlqp萇n]CίnakF%W *1L4{zR=D ҍ.i-`؈A#%oXe{i L݌zT+%uwΌ\S;i69r>-`gmCaz3~,U(׿fW5|?Tdq&np?~=4%?ZB],=݄1VhY]:am?ށdQ]En}mO^'g1 !O}1O"9&3?)%'L8`%j ӫkCy/s.u>dv 2S0|_+]C,z'-#Md>ˑd&JD[!{YXą]x&ӓ5'!u^ d1rv*myr~([gɀr<+څzvs4A M==+  XI&cM*>݉bM"ͣ1.sMջ)| pD[1= $&1H*O*⵺Ƣ^;?NuJfs9C ;_$:jIQ %^t/wEߙ T\b3.|#Ph6}iscr2. ,k.\Hi4T3ClL`ݑn[[JTPYũ[%?3ɘ#Y|Z∈$q kIDࡌ1%aW (4G'lZ­iQ],HcHE9>]M0EzNΘĘY:#K+BQJz/ c'd+y5* yK'⟿vCN0l#7!8gsfSCT1ҩh!=IGba+<}&1̵74W Vgq̬6*^ND\;hAlTWPal+)(*vYJ Rت ^ &׆E3KoePSOKW1ěd>9-sDwi)99+qtq ~UgM`RS(&kTK0 n.#K;OVr̙ 궲 Cm׋ehc^C8]~ZqG_&d0xjM)KZD?Ft728B6Yyv4Jr6s*;GPztv?K'A|w܆˥~`<]9qֺ<2nnxvcr`*Τ )رzCaFʵ&;xk/Oֵ2N 5!u*{.#&gׄX_ ;+MvLsDxtmq[9aM= Lf[*PjA}r|m|u^G"qx-ʱC96.{%d3^>oG:f4Lq|iH֩lD|2*O&]ŹƹB '\J>PFuUzfWtDLdj!?G-Z"GIJ^aOG?]vrhuQo65j&뒣0W SH*NW֠ DʇXa!a<᮲`^7ҝ׭+׵6hk0B]̚1]^ <9G|Ó:9Jx'B\T" ~m  їHtPdX̎˼tBzo@Qj'jOHРm'~ua/rr>T$cg^koB#v7*2 @E`J+rfWhƩ>59I.X Uz)QRN鶻.Og(4Dn*S qe4SYtqLfKH{^p' ZVg/dIe`yZA_/6 f 6v S?TU[tah58pc?5@Io?9OɦҲUUt73ʺX/;L7* Zs=;f6{ڙ_P|]8րP2מ""kC'K<%YҪD6nAJ~#*< &%V90ڃxZ }ir EkڶWy]?}`b, ) }C9Sb*r` lWP(N|%y-BDO`4|boJ|RR+`O / = }? $ke..i,[%>}:S G>X4T !#s!O<,K9ӣ`e]yMIW@U%OCozTSHM>NFrO٣5xh ?NGzWBXHPcg+뾻yAZlnsʬ@]RR}Ze^x g95=7I\s5%\]Lĉ3dCJ> #]vVR'[VFeJU"P%F䌦n]i7?*jjݩid$s64&y&j<:8ׅe^'li. q圉yꈊ1{3Ur "x}Hp"^\ i*3i 5`"_&0b@oVjۉtf/#aSFڨ֣^|Z7 v&(ฏk7vpkɉ_BT14Ǔߐ<Эd:h‰=׾3ݻ]%˷ .0OK%ņC&svaPC;`YόS=C1 0B x?Ț0[r=v[UlBz"Nf_{&S1ApvO)eZz1+_c$ >t.nq8MvrGFElW=/ui/{^U5C)ZIJˮ[oЬ)"z{ $H c |-RZ3?yӴdI "hq{8PϜIr-xˍAqȑVyCd.#KS"Yd"8~SPaat7Z˥ϊNDlna֚f[E&1ZaΨ`1.]hIȎjD;B.)G濽,p}% ]{]^"HO}?9A!etfbªv,dzx/hB$`e?FSfg!:M'Vn,I-aym y޹l=^Vz 1p%ۡneJ_8>']:\.q0 h.;cPkQ LAײ򧜢HrIGM3c\P`A-Ň澼p>H!Y9VCmv ^{b4|EoI@(8? ʮ洂4^n+ZP@βSYs7d o{e94Ksb p`J31Д(HX+z%_Y^ eH֮2o/MF-/v,oh.(HP1eDZΓ|ZZgD ye8XO m;?B;p?; Rަw,@sPx'G!R(Kw{\xӄQy6N/ZӺĵ찮ӤPX!8"?f'u~  { iD_{rjC M?8 T-QBmdSRaQAo* o%CKM,Op$U<4[P#r y4}D)WD@俤ɗSǽXpG8lHMB|,zp]Jgi@+;؆vp:GyQ!#WgSlc`wtS}TLtɎJp1 Y2ց +6xvɖ]u7Jw3EW߶-:/,~.1s2Ri^8>0΢2] L1ΰ9w V_]țeΔ JfPi巡A<]59QcJ̒(L;{(@eqggM~(e֜b|@>{R* _Nqۨ=42@ePXЭ;"Pv4oMKpdHOw3 '9hdZX AyEJ -2 P "3jh`BbR\8ұ-/&=h%SvuP+5.tc>FgdDuxؙRS59ku<Az#`B'IQnE P߳ODxtE t B&ڽ{&+"EAvqW\*86kb rR0(VM/xx?'V5[{=9'_ Nl W,Θ"3".+:`Ihoz=*NEP!m̧͊;!$X5, ࡴQ lѐQ ң---%-+AeQÃ$ \mk}X\*ֹguOC}Elm:hD1@|륓5T m,g͞n2_A{4E@U!nL4:ǝZ}$X\vKe^/pesTU`t$|Qj q|b>n '>dP@o7lAE tU6%|pwm[7Ԟwb]d7eIF(MaX~~`>@Ge1Y)I]I OiAM+]Ky AZ}KG:_(Q^e`t9i $tUҊ*ڂ*[nE^71i ~7챽QvNAu|Jj`if7{|jPl{?Ҿ(;(J6lJ7CL 3KH ekƣt(#f,=6ui\% -pVehGoHVI.+VDSs9?nhVŵ!of?[)0On3+e'(=}$ Ђɣ^ty&O+h4N]-J'95M` ĂAm،Q.܋L< / KNX<ӦTb'2 ?/+h14 ?Qq*0yi\ ~[Ws:EW&|u%P E\Ȑ 5IpЕ=tDUKW-+d &X;#PaBd]3V?d! [h j0=f$±'wGkdZ&}nb<9&F#J6CyqqQn$2C~eh6sCc6z't[$w×W-YPgl#OAgL ʏj*@PɞҺ_x8h#״gOC5fctM(W /S_#0H+by&L1 T}GYd3S|~GiQEp3A>JnS,w.H1f*q oRK X+hUC1: o`t"=p.Fq)Z ?-GnmhpeZD&N&J=;[rזbbE {@2>c4x=Q=W'T;ZƨTHg8 qd ۱QQzpbb7Q^]b@O! ~=o09f\u5up2&Cl3:st0oGM:+ya&Wqt+l3Ws2_NʑP 5TmuO jڮZcRF)q뮎 YXRRB,VQ_qEFDͫ*% ]8t!΢ ٶ?0fa֖泹*A*v}uVJel\;MOqӀ{>Vp;|~%54[)y *f$Wr̄X{ / }Еm9sχZ>FAVc)#\[Ѱ򄞒oˣ`Lo:6"屛 15C/M*qrl^/xQȲk L(GPbហw 2Q'T~!Wy"O\72]=]l\UgF|2:) ڬ2|ʪK[ydv]Ef8E>?bjlP>sc 5REoPQƌ+"48Ib_!TmkOD%|@ wJhܑ{0]Nݵ ;s5)@Ug҈H.*|Ҟ/O_^AݫOE٤NTc{l? ÔJ8ͬw5Eؔ|Eby_h_|Չq'2s8ݟygEa8H/C7ܴѱ6 K`Wk%Tn Qqz,5cUzP3J3sM:x:$LB=cj D-i7޾mor9=aw֟Y %` ,.ʘ)# uU0GV,2oG\`ib?rP'QDÿ$ V.BNŁ1MOx 5PFUfFx?/b;Vc uԜZ>q(9y_(r[ f!FO63-B "Ii9 : 4Lel2~ _1!Wmo]7(&@dkO* Cz<`pq٦ l4 k=FɾY\UeTe`п~r:WnrkzD6l8| XlJN>Yfmu < ݨڪ*ہJX߇ oi!Twh?熦6y`P䶘J쌈n>f;D N&9dǖ dC͏(`S<Iބ kJWPt.ѩATx^FmDOA|7K2/on'ZRqtOhÎ=^K}{teG0 VCevwY7'Vqw>I֒dm({%&5ԯ!| n/V%k|y`:C)xҺ+^RE4%}&lYiiPV+nw/|KRYe3.^n5mQI+M0{eWH+1bvXbҬucس8(E]SVZ'*ܖ3SX^pF.?:i3r#mR\+'fs郂":trHCNl`Bīs[# v-ܕ"ۚT7(ݭ|KD?rxa17߂B tUQ)ܡ 2 tzzr1`i@c輵#, g'6 bVi`>q܆-_}68|0Nh0alk!`F$6ݶD@Z |l"U/:<)"肻+su争uWdJO8; lX,KF?ڒMETf z0"tcհi"F@/ȳ]ɀGv+ 8 VR+e :F'w|+O=}…Cr#deog#62-@Q eѿl+bj:3-W[x7׊z ~ʲ eo +jC.s)}.i8 q-d#Ⰰ3O ^6!k@9iշJF  '94»{t/푏O lAE /㌂-Gg UY[x&I ,oꧭG5td^/~e$IɨtHaR֒ WqGa GK 6/kZzgg7&e aMkԥñ3ѦN7n&jAѿgk`H>&ā7?g4=h,7Vp=AA]U68" '}#|hNC$M2*^,X1`9A)$?t|n9p5\Ӥ#FpZE`x,3 X6("$@RTGԬ!QVmQId~Z@n5|Vljn0fci]}lHF)bЇ|ԗFlt{ɶq-lEaA"7VE ͱYrce+Ja(k /l>( 'UYoD  z5^-om0ny~+&já2ɚvxMʱEKH)n=' /:g1H[1#~򁮆@e]x,w%v"W'#Z/ebs.w&ikL b+*:LHڴ";Gb"U~g9?M" s@Gf(L;fHn#_F9bTח+MQ=(%a5C4Գph`yKaG$9$/Y[L ! 8U gO5Tظmm7ɋibPխUm\pg5 `H~$(,;ՆSqbElIM}N3)Hg(v-xX[w utVM!H+TnT&=iK̍njk"u%o;/K!c"s6e8EѥW~d[2܂J jYk5':Yg g$%,0mxd6RnWl8jKl£!o: ypHWXmso2vAJ$N,"]٧-m{('I; vmAu9TtyA,&9|hm" oN@8sⷳ,~"tsL'0մkD<`N#(L#U3!_|!r,JSp<#'cV5oS7ק _cZiW-B#UG}#T'xt=R"̫y.<F}*՛̣ӧ"VSf79tOt~ٵzmHk*VB wc7\+rc{m" ))? *IJTaHy0t}!2 <1󑐠tX.%7cK+%c1i5M:tԖ>R2yx=aHX'DH{ح|g_B zT.5%Z73݀@]96ܟ)vT`16O6􌉆^4^{P6ts#-#6 Mξn@rZZ*`VvJ(hᅎ`%S%*^햤dm pGa(^)ßOK׋ eGFdb7AظqEZČ8~ Dӄv'f5iMEDYY,"d-lnXtBh8`t)w%`m C:d,3u:U@殌="8W \f?=ے/2_+>2B|-F2APTx`U;qV2n]@N۶ /]|&mF+v%aK_sDy9K: ws4F:1e|SԶ64ʅ飧E_bTwHX# COhD""qJc-7Y^rٱ3CƓhuaI'a2nI4K4!k` Fm]NΏeTM۞8W 4[ƜĀX10!_.fB  ! Cv>U$bt{sA(KDBİXsB]( Л?Z3sFN.Dkh w1`?e"@uMX !v'CtT$AU7%OJύIL,[w#9GvɘU2ˍ68!t%%~?j.D)3x7Bau(U7%_#i\2eCڊJ9,<0Z3?B+ZgZ \DmWE 1j,,b&S|s덡gƑ:%bR {*{MaY⊇> Lϵat jX@~Y|"ԭ)ۅhH Tp aA~DxVm:B;s (h(׭em+=;9nj#KQB*?m4UAb]i^n*zpuTHu$7 ݏx/ k-lPuDe :,Y;ۜ^*v^}c GN"EvZw~O\P*%"XQg:>SCnVp0BVj4/^e#V+ ;f۸,ᆚ ~&0Q%K"5ʆؠ0-e-!dΘ8SI^L =y+/hڛͼ]\@F1rgkME~$4 _ͫ5?d!|CY)uS줰}!I|*Ŀ(fey0- kBT .J)D<$e#gɰj&3hTğ0wVyKA3V=,+ǣ!aO\(.GlU.H>&0nە03/PY Ox(\AP!psDyI}ɽ3Jzvx0)@(;}3tVٽj0t rG:Z 9洐-EG0&ٝ4\&|fLvsHqT 8ǃoBtOfm=1D#"eS U@,%DgHB~^%wP&=L$^2TZ(s znDP7Qgͅld`Z8(P{) X"ee0* L?p@B1{C.e:٢BIv@Ȩ)$rAJ#q 9&ijixP?J2n 8&=A{/s# .04C/x)bi6P>|ia:Ȱ|XD5bg|٣ y'86@Q\g[[_8z>6-όh)GFu_]baLכ8l+5'mksp64ؗ[yRƬG99e2 9Κn~Fnb[9Jwu7W˿jFi ?,n7u]=RZ |b slwW^#d fKF0*i uɫ;C~9M|*"^ K.JqK9zyV~qڰ?Ӳ W䀍fR{A*A@ӯ Q,aů+44f3? 4.lj`0iF XIPrܡ`Fϣii7mg 6AZxdv.W3d Lح$ۨ4[^<^Eޙ ŷ30&XbXlQ~0̻s=xݒܘ;=Z_$BҜ\;.lYRrKr8S+**PQj&?ศƆwA<ʟ)sÜʑ^s*(̝Ş Ed=fd_Lb-a-ujt<Ao^6[2BpoD{ellRϨaOE2k2zA<* %u 핬i)hs %{ͶBhBgBVB{\VӉ`PM^%px4MDM,}\f˽p;ݻ>2\|84J0A?,0$Ǜ&¥y{P V!{D,'҃EOz z AQA(\gIJ5X@}?޷64Ruҏ[*2Bp 6bsVD~*_4ⓦ ʋs}/[c]cH}ZS%=f#8RCE#J.=Fwe%g(C?IڼAZ<gƑz" qDPm!$SNER7JNVsE,P&VC_Yg{};4!'+_=ɻzx};Z<Ǣ?\i4g6\Tצ%jlo崟 ?!0m?8?T1w !,7b!}× /aVQL+HX-U*x| 5ks$Y/@4Ά'PՋ:SuPĺqWjt6ј_TqOzZq Gy_8M k!)@bKʷV3xIy~5KBM3 f˯/ciDzNrɝ7a:c:Ek{kŇ^,~d_]SK槫ƪP; ;MI`=AxsqI|AOV7Sx毙əR, "cE1R1&7A]DP N7_R#e6rM믺7~x/B̔KՍc؃{jx^X‹ĸTM88,iA۬ם8t}"Qk a2#- g5׆wɒ/Ǽb,jԧ]m_Gʊ6㢂G`\EYc JwninU^T= +a׳aȾR̚MI-[('S3$r||[%6ԲY|!W\I6 ;38',d/c$HedRjx}a~NbTI+W7QAW>^7 %||R!:]ٴvhRdy&9oF-CsMڏvZL7cҭz+"(Y{a> ⊊ ?:{90K J?kHȄ0?iAy IO?+L*.,Wya!T43$a[d\okx㚜h,ġ*_EM$$1/2)UD~)Ev03W :g=:"GòL4E(WL }kLëkz?M"`VRƠdqa.ɡ=J' p]oansI$w&R쎘&pMl[M gW {RJNko$C =YM"uXoyةlecCf{&ST&t>'Q6킚C9,eF̧ [.5ȩ%aU-MR/_SE?^@d1kn@A vpX9 ذI [N۔ 'c|Ll0_ۦȇ,|ۚzD̙uMM@??U_'G:8N2lA1W_4Kt|B CX[#.v_/ς4ae]µN3Ae>W#tJ6%:92Ptk§ݢ/AԢ:>X:B/A]ޫT+KVkEF(Nޒj=Q 0V"*u2&E5DL=u4r(]PlZ[O?sŒn '_3X~9PBpJ_PfJ< / jv#y?L#Oq+2do꟪Kz! 8g{𱶊ʪ[0.h8ᆴW`3l٤+`s!>YHJĥ_q'nh,%m{6dAgWA^qBSnz~d?_\@ߨ5|SAF! =:wzICKtCrT =Maۋ/K gܺ|g"d3_`mخsdӓwI*Ϙ _=Zմ,%ɽ/C ٶ9+x_x9W(R[!\ħ²4@Eݓ2w 腘`~b#8BmҪgL0F7G6/_ qMUHLh[yAcaY"Vavm\L̂R_7<RȮϽ)h؟ES>; YQXfP ;Q=G'fm;GD m$!{CM 7$X `bBVaX# ɉRkt_5L PF<CM~0e D\@LD &fjb. K;/O( ^]5۾XH7I 1}ygY fBˁwxNsf8>M'I=y"rY+"T"a91TqRG Dbw0ϻE[ԟx`zqɆB!AZ#ר0zcЛ>jVVͫn|\.W 1J9XMCoPgIL+ݟ |uErd\ Oh3AcTߌ4:I[W4"E;`d_/,V<,kwk3ZS'd>q"ښ"%푒D* ZВPgzv"QuGg˗*SǯNr&Q&<5 @o *rX +UW#J,#RF8@LRu'ٍ~gb"ç$}]MW@EMLcy' dIzHس@^_}ɡD;8YVqt|R{:]+d]ֵRpҜt ]莘ϳ)[_kO!CqyT?Hl+d"ZmլlFx .];H.B T 结;4M@R(1~.Y@(MWEyE}sPAG ɘC @xƚ)fY"Ec@}>.J:>*P?q׍M.l(v^XΛR߂3VELiX"D]g%I !"MuY\Ha*# *LSWa$IvT"OKA;rgʈ| [sz^_ T#5KDE:۴;7/M 23/켇k'\UL&+իG~ŒH5ߦB->#nlym̮M嚒|Hs2fP"`:gԃ՚M@¯Ǣ=jaX%<'13SaLgpi`9lY6bGj'[fZSl9vQsnٷejmzB-m9<\^4!_Y?zC#`'P[k9z1 ,}ɴҺ\4(WV@\ qlq0?}p(0ښ_$l/|D&xPKa8])sI|tܩ~:[%nAIr20%'Ҋ# c>VUE1^"hI\9MgX ̬=ega~4o?z mVsq5VxCS&=iIyu.eBk\:pJv)Z, ?mNx g{w9FjH;mX9V@S"zex ;djg#@Qq\"1\B ߂#Tz@M20z|t6wS;LN r۰V/)R%/ܱSR~޳뙝BQ`QfEyUF#DbrOZV`4tBJXr1@KɊ֓dTڧrjuH?152rfcJTiՑH[~pMT8cRo5?nzM'XP45}70 A$-F}#${|=D mv$SG>61&. n+#oc,==",Mz53Q`@ϢjDQT|/+|+_7p8d BKE@njM]K<V9Agl?T(&WM[gm޳ֆCpT,x q bujAi&szԚP8rsNqp[j۳S I8 Oy7Wڼ|uGmtz2㮼2HrMn<ŝҸ`}{eJܑbD#tsaZ]?nm<cFRy#M#r&YsgBk:CM? ,7fT"8A6GBW ZƇNGf! ^߇si^['r5eD9T<&̑U:~#v>vh>8Xjb9.7A @j|ṋ2#{9Q"zytZT3}_rl;eMZ<_yZb/buƫ:|pP:~T )D|p74 kd(kg*dgVX_u|TzWdOIYέǮ`Xտ0'8_HhUרV@|+bsQW#[)]W5yC,9h@&sߖ~^X)j*8(K~l+SOaCHR.= ۬_`Xxsy0cA|o=yD῎k7adQTݧ@bHf<0(!ֽ.M8Y솸  ب C TV<"H ;udoݿv:2Q&`fCq75j6r ˞!t&bӗh]!E~[*ʇk8}&_w:49Tzk mkZLk]λ72F0nL[&v.忈}Ϊ񻰯3mC YS"j8Щڄ kkýʉ+G\$c͑q foK`n@Ȍ/\|#ǷGUeL'[&"x?Ӊ4ˎy)l~:I4x,ղIjmF)- :4ɻC;}35QqLhxeN;j#݄@ |&" y`n°&V {VNjoX@zUұнxYey kJVXM us/.IܣDB_sl_PFL`!Ĥ.jU4/ptpyZ ~'U۫~sR5n7)_1Ql ¥"ǭ\}`ɳYjPeiEvYpIf[쩈K U (em_pOP?pd=Ҩ SRs SIJrCIEvh/8`sw3 *~2̋~$(ͪV = >֞jV>Dǵ MGg`E W} <,i0B']/a"=>@hTWzQe]ޓ F6~+aOWv"~q!.غWd{Ky* \pRu9Z5j1/|XADQݣh`mڈYo+s`9#!0l.Wx|IGq[Q 4 7+"j`@Nɵ2%Fq x1XHa؆co5ŪQ;EqFG]P L0x2шL}"[JIfI>kEAכQ+ƸJUۭtora JL\I;{foa ^/H67nGx [K?  ڞ==y3w NcK!sbDts5aY̙Au-YEFDI5'6cx*=#!dQN-*dIɇ|$fH]I+ (xKh7s&"e2| BO+x,R>"*^&Ȇ-.8E3`J&` 'jgN wflk BU5lulT5fS+Ae!e; sԬJ$NiLA6XcwSmn8nĬumփS;츴Z(r&nl6|GYAΌ5ƪt; 1pw̓[s:&WT;PWGL2+7`@_ d\LۙDqNaݱ 6'O:ۋvPK33 PJ$͓=_ O1{{hїhB$qG+5)h4}\(E Cە_sѤYhׂNޕL|x =Ȉ1 GIm۳3>y\xŶo'Nabr\)}RK2E(= y GhkAW_R%>!rUv:Ez]ka/FIzKI2 t߸~{k 14gݎƘY۩.y4 naLYLGT+T'gC/1GTVIdtʺ~]"ip?&ꨀԁq>*=gv^_ds^Ͷ٣#7hFbO7O+_UuJ:ѕBVKBq 7쐘\ +:Qkn4qْį=scVaub9\^"-уK6#H$L@f-0*. Wjd|kqiwR;nJ>vD傐Qul=8[HFbeRͶغݞlg{O_/?m{(ZzDR&B޿,%NXbrbyInL{'sl.F2 %p3)VAcoSA x[s{^ ,e:?~Jd5teo+BSN+>w$V 1`(p2[t>%1' 28T¶<&+ *]^kf" w y1b\O]AU;4}bEyjdWEDŽ?kNkKQSt?tbf)]Yåj^مl81ɓ$8jXݩh|R?A\H^DLq]}M kiEh Y 3gGs딝sڨ^>2{f۱/)% [KYƄL!BN.$+~C|1a"ŮQ)ꉪ,}c`h3zJ77|uy 畑ڄr h,&sbE`,ABACdk.|Wsqkd>gM\-Sw4e"J;-s-k"0O7ɺ]_=HsnJ ԏqcXJ%T&y7)g-s']̇=7e^P &d"mzfk-râm6$Ce>攵Llu1?hZ9tvZw̟vJ$9ܒfwjMa+@ZJW]J9C`9fnӂX; R2K]iJԁ=0d~RCf%fhSRXi kUЎ[Mh_=.} 䙁ikFSdӡf$eHS5LI=- s8Q⟴) Pm5e̤8px71ԱžZ)G"g7Fr~n"G.:9Xz|aœN:Q?Jk+L}ly:Ƒ7X֯#J|hYD)sd寍ShHh7&qvR xJz {ѹO%{|g&H1IXQ`bm=e ͺ8g&" f'Zd8du. FuxH ,c*jQȬ#Z^U{9sZK κڷfnb*Kxyl_'?-afj>nZKYePOYF9+Ov玗z(z .J` HCGWxV69%= \Ls2Wf1pܿU~Z}NY_,ӎlC\DTE,@E:pbAn |>b8i,Fy n2K~۝҂b ~.p|RM ϲ1p6\\9#8Щ%!7PNkz {yhm,z1(/S`X1ܻR , @EqVԬUkXO,͹j \M\Sm-5 [[@c=JTM;P 陴4u%m0Τ{֐ AW@ iׇљ.-ަw= fGG(dURo+֘S ?.m޲m{d-ZWˬDb QoGϐSkl[ci_Om߳j$L=ZTd3Dg C*u78U$ Osg?25U_E[~TƶW DyNBAgcI=&J΂/Pku= ú$GUJk>\feSIbǜ^5%OliEL +VV"5|^x`9CaDx 4_є?#uD/ZRFmhÂUˆÏvBQ.˗'vn$EG&/⟭*81Q~+>?ctz7+niYѰDFVCCK`ޕЙͨ!)Gol-%ɤ寝+r,z,cS\x{3#vNX:z-M B1x|JjlT>^S CYn~"m H(e[ 0QQQRM9q.)'&4O$-(>D&ͼDw-ZXoC0A~4w]Ƙ{4t}:ꖩԌȉ/7Qyd >g=^H kj puq0N۷>0_ƮLPl@AntqѢ~^%Ysdpl(kRD~7XɄ?Z]j QAaZm'̟*U?UKj$l#mRDzBW|17h_\NUNsbի>f]h%aꯢ>7AH )=ia*So]Iۆ ԍau{v<8.7CTP'[p(/ _4(-]؜( cKz"# ʺ-X4k>Dski51.<էaiר]ԋׯ]^>hy?~6-f+KDmV`өwm6[R$nA)ݠJV g>Xe,k;"^͠No('ȗ/xz]aKfe\7u[ZY~H&Mp; @2tզ6 f-9ˆknmTKA&~ $+v rJ,X-S#j ^K |DTP&T1mZd<݀IrK>K_`ufHxٖ ;O% 37PDJ'!㴧"gpg-!B ?z0f,"ЈwL c4^+OjMp: mˢO/@3eΈ'QW-1%h(_5YԦZ4$3y[AJ&A k=*!ݰ(E7Pk51ݠ\`,7fOk#<}Yr8fQa%z(Vq3+C9 BBk8١#61;*Lq+/z1VƱ#Yyd 55>>nH@+m5BfB\tp1l˶(}]))&ޕQb x*,RH;2m@GohgH.7%Vd|i2_H'f2waCk o^l!]]eIrOzEy~H$KT4\$9=hz1]K3[{&i`zl1Pz/mjňi˝ [JqEkF\6 wlX,A| ڹGȮ?C$ 8z(Lw{/7x* eD"ٯlױL)evM~y8X,XO c0*+M/ysW HXse4W?>jzu-Cpm Rr4F=J^;an<4 ʓѯ R$AsPXm-qm1ul-I)Dx%>)cx++9zDeȥ=4HRso3ϸ=EppNrL x=B@Lf+_xwQȶ*['MemM1ĤPe7 1iJ?Dg4&`K+ L-laPC寰 ۾7[pCȂ]EwF֟ZS~Q# ?B莎$ nPݱcQиZ2"C6VԻH@=$@i65Ʊ`)`7\\"bfm/;U3x@4Eϒ!~2Uq`ta=*4(Xy'^xԂδ&ΧX& ,/PO !}I%uVqbP] ~T"J#B2w&lÑqa|M0-h>V1").')GA7sғOJ7'ķϩj Gv^RU&dBҍ8w7RO{ W w3תf!DlLa";Q{̠mҤ$-2r<[pM54hȝ?|*grj֝ܟXRQmƈ ]+4 zfM\Mt!KbSA=!zRkDZ֏%gmQM+>OBM6je|{)l2 gVƄh=ʋL`Q7'Yalɩ_Mr߅E3AJxڪsbH$W:d|sƹǓ(ƻVȳى4u**~jq6?#+&7tkt ϰXWXL7IY*IoIrM BF`u^n[6-G  G,¨cѯ[63(x:Wľ/y#m}?Sr)Gd+ &D:%Bynkk,NJ·g|ey0Lߞћ, CZ{8+bg]$z%1K-9mI,;sAJ.=⧲ )@T4QOyULCC@U1J\Tb4|Zsɬ]#cN9#EF_@&S&#i>lB7UȔH.C4aDѢ|e۾LGpS$}DCo~ˤ:aiG9 gKbr65b/B<>'p9?(45\i.$+MV)I%`RNDձeN OK˚H'HVz:hz2[ QZWO fv\ yܗ΁(A+sa RY1$Wu~ 5 |Tu`{ 1IvXv*s;bK lA;76LTDpZ0@8 N`S ppV RR:ǂQT^rt g Q^+@l:c X{|ߕ ţR2L[F =N ; !~]>NU%-~ G YFAH5*gj4 ;%Le%*˒HN#;G4_K>7(ɣW3/Y14ǫ42}WҮ;C#݂'>œvwu4>[}/`s >g]@ 5Қktu>փ xT-^2tKבbsr@4&^1XděSϼM;#sVb|4.93HeW5Nw['7y('l)c_l,czN(+x𙼽~q4(*_NQrVj^]T^%8q\&'r#;&#dN*0,ꇠ $^3m잿~!YU9m@'bLwz">:V5ՀK*Hij^*6I0܁0Ё#Qa_].hZp#fAW*b9lY-FnMO%]h>[1{" ͛q2O!WyD̨ORXahI0`BJ|å0a 4A/`1%lsDŽ^FéS7<1C&H_:?uwrP=( 8LZWiB9O /\2O*"CT3F=+cè#Ep[v /$@d#~vxO\XL >rs(fz1/Vmy H~}G-% IS !VPk&%,*(oP> X5}LMU2Cf4?\h&Pޢ#sovAJ[8w2mȷ+ke2Y&QϚ}~s98u+'ͼ·ԅKLG%4DnIg]t;諣HSOO$R-Tg< QƯBV'מ=m'!;/ 3,BNWYU=‚תU9a8{pz]dAcLS;tEW5pdjv زN0Z3G\"h"mVEU-\CѠgos?Լt F !GU~^55 GʆH)45#٤PJ:B3XbPLsJD7z, [mv^~ݶ43ueq(E0YUdy+w6eE51@  c䃘l9߂@] s/8 LZr\Ր-wV\%"7;08e';’[7Hr" aG,qNO<00t4)"SHa-B9KST&ޣI?5rY& 'DT赘z"~Ƕ0;CEipZo{0o&BcWLDS<0HG}cI0`[(zc mܺsU=j{<)EGk@x*@b[4~iOju G8Vc塾A&E\.y ne9gTy 4^'4 qcPpÈ8n=^Ϫ~_8멀I _3 \4orRTN:׿3w|SZ 2BVշgqHZ+{˸;mSF4>*O%T92a<|RN7=i>`\t9*ώ-c?0C|es_rwU84`T񑀆 Oc ~Zl>M/B5Bװ|D@,(j!'9qœVPiCiٳ&v C#U}W=X@q~^Kԏ9Ж)sxnb}.7ĹlQV|9 .K=Yn6Iuf% XZgWN.LƴS6HnJ5ʩe!AW62$cJ/"w nx1Y'y+e@ ~健HJH.ކ*,".h-m 3B[-=&&\]v˂Im?44hseqc?']`!zC1zk7Qy.\-36WnPb73s@MB7.Y0WҥsdBMYxYLd|c|覨C8ԝ!+2CO "=uF=Tɻ=B TEaEcKM1PMe%VuboFdoky0 ?ێj=H ӻib,{OzVj+M P3F4p`Mf[^5TTSGl+4RzF0z-H| ;m>Il3wDhsڟ)6P5N捓gޒA' Z.ðMB ..*=0IL_mͬ^ƏQ]3] {Zp'sHc,K3* $9\? ; rφi+ʇ~@[VPI`:__0"2",ːnv jj"ՐǜaxW֊Og.\`E璑< 汆+#zFkzBs[*+Fɺܠ?Fm)Gщ+FM@ `]f1or[1݄WVYFj>)-/L;: &M<#> l!$$^Crv'I&~iW?RZ}O sˆNI7OBϓouKqEܸUSSG 7^#`& GpJwituʿ+䀛>%44sY.t(?PE;$o` 5⌊fM(*Sg֛FLAO_FV@N~ɐ[R$i\S=$;Y#yEO19A\:y\'O眍/Tb)7G\ISCLhy'E;$+GɕdTIo=mWJ!H+ Na2nnJ `JHD ^5Ν!RCEAʮ6ԝnk Z&E(]tpҸ\M"AE^%[JQuLB \`|- ιƘ0MlLb |ghyM{xC%ZEdt953#Ӥ] dwfL2l.k)mr_T I?&b يùx!eN@Bsiq̌~iwq6KF RU3&૆rNrA ᢜ+%xʆ2 `+fDUmK} Ï$:n5 O_whEۧreH"z*A!D\ f4qyތ@2|0ʿZr#?WV9á>깃o5nux=m{[eRt*;A7 g/\& n}!x<6dπwe^$,RtǺ߮Τ6!X.W/>a+*wֲEFȑTB03g_+jJ uF Wm5X=a e^mV"N.YS[Ǝ=^^Q`ib aCOX |4+n @qvRe8qZIYzFȠ^Q}=&$_ݏ߿qO`>@>ʊU)'KEfp0t[=(2zi?wp%K/ʩ/~Ɨ}+,Fr;bvYB~i#L~%Xq"ϳw5YT}鮩ex +0 s  ֊f~tǰ~r'12F#$!9Ěi{$} 떎?pVmad_Stsītk97͠:X|A[sߍ5dL{hc +rBH|wj"ThuJOyb$7\_Vz+Y Ⱥ0O Eu ,M))NDUMD(?N,Yg =t894e0u]eЎ+?1/USm5FLp8aƍ> O.%(DlDGWCZHUEBV,U c:yZ0 1rQB#0&oWʑ.@N G2"+1x^,AE On2TJ'btq"GIXLTzR zja8t/~Qҷ6;iʺyyީe6GFdҺU0Nުt3,[ h)&P@떡T` ;ܠbĻ;P6N9I7*(2Ci$)鋯pM2Oᔪ@i kV-3{3}\+`'?s\_Q}1}Hd<1~r\f=V-))܂Uԣ Frhj8oolX\eH-U^eGB,BlG@(]4fw-ռpRWNZh[Xo:@MU(s*8EeAҀ {MNWl.R# 2oUՋ2KXs3sXΚ٥sٟ}.K WCה=PD@ ߻-ݼ!G.G_gA l>慩5sr]#صtSQ_O\Sar˛T>Xc֋pqk>tHL,JiE7&'=L :P*lݛ5 d:_:یbpFKuW+Q4Xԩ9 f6~iNGDaE{+KO}П֣:Izüi祊)p㤮~ yc,7G޽ZIFOn͓ah[C:G`EEhf!,K=ռAofOIc ER=WsUYL`S $(# ^S8,zG5/Tfn5!I? Y+ mMД ੬㩲Hq} J¿lMI, "esFǼZM?n8KߊƇ`+QKL8ޖ+QM H4c(DPR@ ɂޟȃΊcmKwPJ,+K ..0}P ,T_g>_ꭁx5:Cc';ɹ 0oW-CYG\/+866`IXwߖ"!""y'E|TwU:,Y{*a-(0 ^}, (e53eQ~10~l]ܠ67n7M[xniobP$n$*]WJo˚\tTX _E4J^hbD{žc3[؊ق]ܿ=~ ${JCvuPoB|Ɓc_?z1-S3_swFQZӪӧ %FGu:7`q2h=)/ )m1ұqO ;Zi,e'dZxE#BD5 ni6O =HNϬ'5,xPe?16$[RU5~j Ҹ)~~x"W<+zKT~pǐ򫳃̂$r,G 1}c#dj[&e&lz5?DI1Ӊ"uB^א#kb vRuB|6!L5`<:hX́F8Q={: (EZ $n[B[^v:V4k?V~>8L, $פEOV@{ddWQJ ;%fQ cc(m0lџCj]=8o${ .9408LÕ6 158zv}ldL|dHF}xLS/z0N;wYJ0 -e ii-+4No9`,tU+]F4)0#xj.h˾=BXD0GT+'l]0}aKrJZ dI4-&a!~ʪY~+cw^g#|| /q.*?E?7 bNdi9xtҰ*}~?_y>· t&ށ8bV}.}(_YqyۙTOg3?;ϞLݓC-[Y9`;!:˷'ȞR0/Ф^*aiD<+$Fo8Xlj\h$-֚60l r/|686> RLj*ncڢԸ^ɀa9}_dv5!Zߐ},p[]\5+G{֓ת0K#7pdح"=ܐ⪶1hZ-AF-Mbz@OSR6}k*i3+B&Fn+c9`3'|a=|A羍?uu-,IEGs1\7A:*fuԊ魝&8-òG ç2FaǓ L x)ՠbrZtŊ!mp%')6KQjs,j[ ?F%'0/s Gq_O,4Ӽa 7rȶYLnMp%_/53djzPm;Crɖ~uƷR#۬/ *R<^ JBF2h]) B`ZOKѺߥ@(iAm'aF%nOVv,-.PþC` DJ$⦃`rE&N&kns"C3؈[-5q7Wy\|@PB\]H/ i?r).ScAήwD/ j_wK5.+BH4!VX.hБ1jB՜u0'T%+ K5aزiP%63DžZU܈!-xB Cm)lFAEK2ShY :=hc66WT "!qSvAicIUwzKO68`3tq@7 /5SoB+O!,.?=l]yv!$ Cp1G0+@ʴu!0{$$cY i(1&} g#NWBIm>jdfm!Ϲ%T9mV|F0: [o[&\50gBU2$.ly 5I؛pٓ࿸S\t5f]/~ 1Xi b8 zX8Tѩ #UeM9Ci i ǻO]f5!͹|p16P<)x`qS73R0zf\`cd ?yͰr5G[bs0. 5$ VDnq+A#e!0O`aF\ף*Rof &廛aGsLѭ{-e^k<2OleV^qlNYTp@:/aGfEQU{oA'i$EvifnvKvd}H)#DCDW CVlkWƞbedniĴ{/ )Z:ltJNtZX-Ebt7 jSxl/c lSRbp팙X ܥHT(#T-™BS͓֕>>P#h-ўkWRW qpr:֜62<ԛhU*yok:wvm0Wp#N9AqeE)q&Ro68H^1Dȏ }V0dt2y;DQ`y"#RlD,| fRBEJqP$=!<ƣRRSuTeOأ Q5f#͆.¥+ppr}qJD́h݊j~K{uJ$bհiO!h!*, YZ