ELF2`@@@8@@@@@@@@@@`` -(T(T`(T`@@ p,,@,@/lib/ld-linux-ia64.so.2GNUSvx0n(~QAPG9`: &^  4@)m<(#XQr^6 %Uu\ulTrt$@AK5Gt(Nt,!:Vc \['=5?7{M~^ jzb1 D3FNu|4&T9_0FAOSwv07,sL$=EZL )6"bXW/yF #XND'U6d3 hh}'k" |YdC}2Gr|l8!vuUc7Ly<6nzq4LIK;cQhssazE/ n  $1[8JGk&/ez'%:4B*P&oYmMX|NHAW2Z@I1wq;k WS}yx[LpyOD\)aIvp  HI9n%2Vac^K^a$; T{ 4l.G{ 6c91nCV+h&wV --<J,f)9[=='Wd@jORZ|{C"]:b~h>K #NE(gD."8,jCZ7:p39~ {?)Mq>T#5X&` BF*?ZuL+A;c0BFxWe]aPOm3W.hwwd+f'W.hkYi& nTs|!I<T[}lVk]4OCrV>+U/(@iY_E,#P]oHP\3b^58NOg_t2o r5\Zfax )K1`1;=AF=adJ]zM>{qf}duJ+)/Hbs?y2<'~eFybElY !(BqR,M/Q  6"Li$pp:-Ru=,*%%.H-D4f t\?.}iRH!dr>I:N[\@Dg;H0z>" Y!c$E0x?B#-7p"XmK  %se-GqDC-U8elU%X8Mi~#_<Sby^  ?/v8 _qYRSGMQ7J!mg5n@} +o6*E7feQ[`*jg |v9j{` <Ssx $BQ2e0>;JUgK*AJiC]lRSkjvzOg_]+3TmP`_.P*`1Bmow2pIj5k~wo fiZtxroR(tV3y\@ @ X@ P@ @@'̎`=T`M E@] @@q` `@S @@@ 0@PAT @ @x` 0 @ }@`` @P `H`)x`2 `.@L`p @@0`` Y@0 J @l`` ) @P  @  @} @ % @ @0  R`! @Џ`?`d`c @`^  @po`h@ `V@L` @  Ы @@ 0@P` @. @P  @0 b@@   @wg P@  p(@-  @@<  >@@D  1 @0Q  `B@Pd  p@ ? @pu  @ r`  <@  @  @?@@L @  1@  l @p p`-X` @`   @!  @3  p@G  @0] \``u  @@  P@  @`  ``  P @  `>@` ` ` T @p  @@ \ ` 4   @I @T `n  % @p{  N@  00@  ,@` $`   @ `  q@ `  @@   u@`2 $  `@p 0 H`>  P#@pW  I @i  +@@%{ ` h` ,` `  @@  @P D`  , @0  p@;+ P`3  a @@  @V  Ђ @Pc  @z  B @  @0  3 @   @  W@  @p9  00 @ x`  i@  @@  0 @  p@  @8` S0`q`g \@} @0`( @@ @ >@ $@ @  @`' `:`G @V`c @pqX`X\ @` PA@SU? `T@` p @P@ @ @0 O@ $ @@0@` B @@X @e Ў@`yP`Ԏ` p@ I@0`  @ @ A @ @T`. @0P @a , @`r @@ л@  pc@  @(T` @g@& @` @@ @ P@0` B@p# @3 0 @A`V @e p@ H``zP`d``(M`( 0G @  @` y@0 p@`h` X@P`$ @0 + @: @"k K R@I P @\ @k @ @ @p B@` P @ @W@`Up$` 0F@ Ď`T @H`}: p,@ `@p!8`? -@ 0 0@PF 0h@c`[ f@pi ;@Đ` @@uB X@ @ @P y@@` 0@ @` y @ < @p @P( @p5 `Q @`j  @P&w o@P` t@ 0@ < h`x@ c@ @ @ 0@0`.`@ @Z `-@0l@xБ`(a``x` @P '@w7` й@P @G @D` @+T`6 @H @ Y ; @`a н@@r @ؓ` @@ @` @` @ C @0a 0\@p e@`$`X`( 9@` @!`>`X @k @D@p @` @xX`@0 p@ 0 @`k0`(`0 @!(`>`O @p]@ g p@p~`@`|`` @ ` @P @@ @ @( - @P2 A @pB @!@ R j@ \ V@{ @r@(` @ @ h @P  0@0  @ ]@@ = @` `` e@( p@3 @@Dh@M @pZ P @0n @ @`z|` @0 @P` pB@p `W@ @@P 0y@p` @ P@3 @pG`E`iP`(r@p{ 0Q@. pI@ @@ @@ @@P q@@  @` "@` 0a @ P' @p @00`P ` @@Z @ h4@BT p@@u 0@ @P(` @ Л@`@pV]@0 @ @ @P  @ @PZ)`p<$`OT`_ @j`x P@0t` P) @x` 3 @p @0 @`( @H@ @@ `(* p@`<`O @^ v @u 8 @@ H@P @@H l@@ :@  @pP`. P@` @P  Z @d`  @1 @;  V @I  P @`a  @w  8 @P  @0  @p  @`  @ H`  P@P  p@ ! @ #! @` 5! @ D! @Y!@a!`m! F @}! @0! @@! U@P!`!``! @!P@" ' @"8`p"" @2" @$ @F" p5@@V" 0@j" a @u" v @" @ @" 0@`" @" @0" "@P"`" 0@ # @I@ $# 0t @2# @H#0@@1`S# @i# D@Pw#h`(# pN @ # 0W@# p@# `{@# v@# @P#@0# @$`N P@#$ @4$p`PE p/@R$ e@c$ p@p$ 0 @~$ p@$ @? `" @$ȟ`$ d@$ @p$`$ c@$ `)@@$ `%0`0%0`H% 0@W% @h%  @}% [@%@0% @n@% @0% ` @p% p5 @% @% 0@1%@`(% 0@ &@`_`&L`-& C @G&`(R& @@]& ` @ $X`s& p@@&`& `& Pg @&`@@& @&`& @'x`' 0@@e ''`8' m@pI' @c' P@0x' @@' ~@' `@'`' L@' T@\ Z@' !@@' `@df `@@' @( @ 0 ( `X @0%(  @@2(`  ?( @X(@@% a( 0 @@n(,`E @ ( ` @ ( @`( `g@:c`( e @(؎`( N @( 0V@(`) Б@,) @ L) @ `) `h@px) @) @) E@) @0)`)x`*П`* 3 @0* `N@ )* < @P;*`\*@e* E@Pq*4`* @* Ј@* p@`* K@@* $ @p* T@*  @*@* C@@* l@ + P,@++ 0h@%`>+(`L+`(=ȏ`W+ 0@@`w+ [ @P+Ȏ`+8`+ @+ @@+ d @G @@+X`+  @+ `@p+ @P&,`%, 9@@;, @M, 0 @W,`q, `, `b@ , @p, !@p,`/Yܞ`, @ , o@ -0@-$`5- q@0A- @pQ- ;@]-`j @@q- @@- ( @`- `K@`- @bb 0@@- Ѐ@0- @0- C@poW @ Pa. `@ .`/. Pc@ B. ` @@X.`g. @pz. @@B0. @. `@ .`. Q@P. @. P@0. @p/ P@*/ p @@6/`R/ @@f/ P+@@x/ P.@/ p@0/̑`/`/ @/ ^@P/`/ @ @/ @0 @0@(F @(0 @80`L0А`X0 X@f0 pV@Pv0 @08`(0 Pf@0 c @`0 H @p0(`0 @0 @0 Pl@p1 @P1`81`0`R1@@`]1 P @m1 0@1 `@`1 ~ @P1 p@ 10@ 1 s@ 1 @;@1 P @1 ?@1 `@` 2@2`(2 W@728@A2 @ W2`i2 T@P2 @2 @@2h`2؞`2 @`2 @P2 \@2 0@3|`)3  @@P93 G @ L3 @X3``s3 @3X`3 K@`3 @3`3 @p3 @P3 {@3  @4؟`4 t@04 +@@04 . @ 74`& @ .V K@H4 z@@N , @W4 @l4``t4 pH@`4 @P4@4 # @4 p @@4 7@@4 ` @4`I 4 @p5 @5  @"5 p< @.5 N@?5 b@@VQ5 P @Pg5 @5<`5 @05 @p5 @p5x`58`5\`5 G@6 @b@6 @*6`B6 @PO6 p@ d6 @b @v6 0X @6`6 @`5`P6 @06  @68`6 0 @ 7 A@7``"7 '@ =7 @H7``7`c7 0@ s7 @7 ] @7 0?@L7 @7`7`7 R@7 @8 @8 @ @ 8Г`58`I8p@]8 @0- ' @`n8 )@w8H`8 d@08 @08 @8 ?@ 8 9 @8 B@ 8 00@PW9 @p9 Q@@$9 `@099 @@M9 p@P[9 @@o9 @@9`9 P@P9 @9,``9 @ @09 @`A @` `@9 @9 0@P9@H: K@P: @@: @&: @M @<: @ E: @`+P: Pz@@]: "@{: P.@`40: @: @@: Q@@ P @: @: @@: Pi @P: @0 ; p\@@$; @6; @K;@W; @Pu; @@; @ @;@`; 07@pu; p<@ ; I@ ; (@; { @;`<``$< `@`8<`M<d`T< @@b< e@Pv< pO@0< `@@< @< @<@< @U @`< 0 @@< Pn@p< @p= A @ = )@)= @@9= @F@Y@8K= e @Y= 0 @k= @~= @p= @`= @0 =`=  @^ $ @= &@= w @>@8> @ &>@H\@ 1>`A> @ @T> A @o> І@@> 6@> :@> @P> @5 @>@>`> P@0d @@> p4 @E? @`b@`? @ %? @2? P@0??  @@T? @p^? 0@l? P@p? @? @-3  @0?(`? @? @p? T@@? `@? -@P@``@@`@ Pp@p0@ P- @8@ I@H@  @PR@`]@ o @  `@s@@`@ @@`@<`@`@q`@`@`p@  @ :A @A @ %A `@ 2A k@BA `@UA @@pqAЎ`{A P@A @A ]@`A P@@A`d @A p@A @PF6 p @A `s@A P@ AL` B@B pB @#B @<@p4B @PGB Ц@0]B@ gBP@ tB @B`B @`B pH@B @B @pB `b@PB @ C @C `"@#C @8C`> `@pIC P @RC @pcC @psCđ`}C @C %@pC B@C s @C @C`C R @PC 0<@P  u@`D`D @)D @V@P`BD @ SD  @`iD p @0D @D @D`D `@D`D ` @D`(b D`D@D @ @`E 0@pE @#E `2@4E ! @`GE L@_E @PlE@0uE y @E @EH`E 0@E -@P E ` @E 0@E k@pF h@'F @8F @pNF P@```F`rF` Fx`ZKO @F @F`Fh`10OF R@F `@0F `Gx`:G Pw@0_ p@IG *@_G  @ lG`xG p@pG P=@G p!@G`G`G e@0G@G * @G @G @@`H` H` H n@3H , @@GH 0@YH @jH 6@}H &@H @ PH @H *@H :@ H0`HD`H @H P:@I @pIȑ`%I @p2I 4 @?I`KI @VI @dI`{I  @I @" @ I`I `I O@=I`I`(I @I @PJ @@J 0 @(J @06JH`>Jh`LJ@VJ @`kJ @0wJ !@PJ  @0J `J @J`(J П@`JP@XJ p@JPJ `x @P K `@&KP`5K @IK `YK 0 @P`K @qK `L@K @PK `= @K L@K ж@K`K $@0b K @`K @K % @L @@0L @@$L <@p:L / @` pAL 0 @UL G@{e `iL`qL @}L8``L`L P@L`(L @@L @@pE @L@ L @@M̞`MԐ`#M`.M @08M 0@ ^ @VM @P! @ gM @@vM 00@M @M ` @pM D@M @M`M  @N pC @N w@0#N@HnJ 0@@1N p$@0?N @MN @Q@ YN a@PlN`N @= .@PN @N 2 @pN p @N P @Np`N @P$`Np`N `@2 O 0@`O N@,O :@p;O 6@@UO P @`O @sO @pO a@O @PO @O :@O p@O 0$@8O`P f@ DP `P @ P 6@0P @BP 2 @PQP f@pkP P@xP ` @P ~ @P <@`P`P`P @P %@Q @Q@ 'Q 0@pCQ @@YQ `; @PnQ @pQ @`Q @Q } @pQ` ( @Q` @@Q @`Q @Q @0 R ` @R`@P%R 3@6R  @BR p@PNR 0@hR`~R`}2R`&I p@0R @R`(R p @0R I@P  @pR @R @`R @S @PS pM @4S`(?S @ KS @[S 1 @dSܓ`{S 0 @@.0S  @S @@PH`S @L p@@S`S 0@ S @0S % @S @T @T PG@,T `N>T  @IT @TT @wpcT @vT @0T @`T R @`T t@T`T p@T @@`T u @ U `"@@U >@7U p@pOU k@@aU p@0pU @ @@U 0/ @U`Ud`U P@ Up`U Z@U @V`V @P(V T@\ p|@0Q\ @ i\x`~\  @P\ @@\ @0\ %@@\ @0\ @0+U0`P\ @\ 0@  ] `](`(!] P @5] @@M]8@_]  @s] @m@] 3@] @%@`8] @@z@] @] `Q@0]`d] r@P ^`!^ P @0*^ 0 @:^@D^Ԟ`U^ @ c^ p @@q^ G @@^`^`^ @0^ 6 @^`^ s@P^ @@_` _ )@@&_ `D@2_ p @P@_ @lpY_ $@ g_ `C@o_ ` @p}_`_D`jp_ P @p_0`(_ @_`_P`_ @ `D`` `@5` pb @PD`0`V``i` 0E@u` @``` @` n@ ` =@0` p@a@pa  @%a @ (D`.a@`Ja`[a`ja`a @@!/ P@`aȐ`a 0 @@a @pa(`a P@`a 0W@0 b`b @"@P&b``@?b 08 @PNbx`([bP`P[nb q@zb H@b `b P @4 b`b`b @b @`_`b `@ c p@'c r@6c @0 P@Jc P@@d [c@pkc P@ ~c  @@c PW@Pc @c @`c @c @pc`c M@d0`d @&d w @Gd `& @Td d@`^dX`hd @@d @`d @l d 0@ @d D@d @`dX`e,`e @0/e pj@pBe`ce @Pye`e(`Pe @@e`e`e``(m e E @ e @e @#@0f @@&f P@0f P@@ >f 0Z@Lf ]@Zf @rf 0- @ yf @fX`f @ @^ `f 0@f H@'f 2 @f x @`f @@f@g @0g E@@,g p@`Bg̔`Sg p@fg @vg @@g @g 6@g @g [@pg`gȞ`g` h`#h `@`5h U@@h @@`Rh p@P^h @vh @@hؐ`h @ @0rh8`h @@h`h `@h p@h =@ i `@i @ $i@`6i 1@PJip`Zi @pli pz @{i @i ` @@0i`ip`i`(i @i p@R i`i @`j PB @0j `'j @8j`Jj n@\j`pjL`)N@({j @j(` @@j 0@Pjh`z j @0j N @j 9@`TG؏`j # @pj @libtermcap.so.2tgetnum_DYNAMICtgototgetflagBCtputsPCtgetent_GLOBAL_OFFSET_TABLE_UP_Jv_RegisterClassestgetstr__gmon_start__libdl.so.2dlerrordlclosedlsymdlopenlibc.so.6.1putcharsetgrentstrcpyunsetenvwaitpidgetrlimitioctlgetserventgetgidsysconfstdoutgetdtablesizesetserventsigemptysetgeteuid__mbrlenmemmovepathconfwcslengetegid__strtol_internalgetpidgetpagesizeqsortfgetsmemcpysetvbufreadlinkdup2mbrtowcgetuidiswlowerisattyconfstrendpwentsiglongjmpvsnprintfwcsncmpwctombsocketselectreaddir__strtoul_internalfflushputenvlseeksigaddsetstrncasecmpsetpgidfreeaddrinfowcscollalarm__sigsetjmppipe__lxstatstrrchr__ctype_tolower_loc__strtold_internalsetrlimitgai_strerror__ctype_get_mb_cur_maxsetpwentstrcatdcgettextchdirendgrentumaskferrorsetgidiswctypestrcollstrncmpwcsrtombsstrncpyunlinkgetrusagestrcasecmpwcwidthfopentowuppersigfillsetfcloseforkgetgrentsigactionwcschrkillpggroup_membersbrklocaltimememsetclearerrgetppidtcgetattropendirgetgroupsttynamegetpwuiddupgetcwdstrsignalgetpwnamgethostnamesprintfsetlocalegetpeernamestderrfputc__ctype_b_locfdopeniswuppergetaddrinfostrftimefwrite__xstattcgetpgrp__errno_locationtowlower__fxstatbindtextdomainsigdelsetwcscmp_IO_putcfileno__ctype_toupper_locendserventgetpwentwctob__libc_start_mainstrlenfputsclosedirfcntltzsetsetuidtcsetattrvfprintfstrpbrktcsetpgrptcflowsigprocmaskmbsinit__environ_edata__bss_startrl_kill_lineread_docarray_expand_indexall_array_variablesdebugging_login_shell_rl_enable_metarl_funmap_namesbind_array_variablejust_one_command_rl_free_history_entrymake_select_commandsh_getoptcurrent_jobsort_variablesmake_word_flagsrl_deprep_term_functionrl_restore_staterl_display_promptstream_listxpg_echoupdate_export_env_inplacerl_ignore_some_completions_functionmake_default_mailpathdstackrl_line_buffercheck_identifiershift_builtinterminal_pgrpexit_immediately_on_errormaybe_save_shell_historylocaleexpandfg_builtindirs_builtinstrip_trailing_ifs_whitespace_rl_complete_mark_symlink_dirscompspec_disposeallow_null_glob_expansionlogout_docsetup_glob_ignorerl_vi_checkshopt_builtin_rl_erase_at_end_of_lineextended_globttsetattrbrace_expand_rl_strip_promptcompgen_builtinrl_vi_yank_torl_vi_completerl_dingtt_setnoechobegin_unwind_frame_rl_get_char_lenrl_kill_texthistory_comment_charglob_vectorget_dollar_var_valuerl_macro_dumperbuiltin_docset_bash_input_fdstrlist_appendoriginal_pgrprl_instreammake_builtin_argvrl_read_init_fileremember_mail_datesexpand_words_shellexp_rl_history_saved_pointfind_flagarray_to_word_listinitialize_shell_variablesrl_completer_quote_characterszcatfdrl_crlfrl_directory_rewrite_hooksh_optargrl_filename_completion_functionstatic_shell_builtinsfind_string_in_alistsource_doccurrent_command_subst_pidload_historysv_strict_posixrl_vi_matchset_signal_ignoredpromptvars_rl_with_macro_input_rl_output_meta_charsrl_rubout_or_deletesubshell_envpshell_version_stringparser_errorlist_stringneed_here_docset_current_prompt_levelfilter_stringlistsignal_is_ignoredrunning_under_emacsrl_key_sequence_lengthrl_arg_signrl_filename_quoting_functionall_visible_functions_rl_dispatch_subseqhistory_max_entrieszreadcxtrace_print_cond_termrl_marktype_builtinrl_untranslate_keyseqhash_builtinexecute_prompt_commandsource_file_rl_vi_set_lastttnocanonsearch_for_commandlegal_identifierhistory_set_postt_setonecharwdcacheextract_colon_unitsh_invalidsiguser_command_matches_rl_restore_tty_signalshistory_lines_this_sessionvi_insertion_keymapsh_unset_nodelay_modeall_shell_variablesit_groupsrl_end_undo_grouprl_call_last_kbd_macrorl_vi_replacerl_set_keymap_from_edit_modebind_variable_valuede_backslashlast_command_subst_pidvi_movement_keymapreturn_catchset_locale_varsccs_versionsh_restrictedrl_completer_word_break_characterswith_input_from_buffered_streamrl_filename_dequoting_functionansic_shouldquotearith_docarray_to_stringfind_user_commandsv_localebash_history_disablehistory_expansionarray_dispose_elementrl_modifyingrl_discard_argumentbreakingcurrent_command_numberrl_vi_ewordrl_reverse_search_historyhistory_expansion_inhibitedbg_builtinarray_to_argvmaybe_execute_fileexpand_string_to_stringrl_dispatchingbash_directory_completion_matchessave_token_statepre_process_linewrite_historyprint_var_listset_job_control_rl_unget_charrl_redisplayset_ppidno_line_editingsh_badjobrl_show_char_rl_digit_valuerl_executing_macrodiscard_unwind_frameprogcomp_insertcolon_builtincurrent_fds_to_closehistory_expandstop_making_children_rl_terminal_can_insertrl_already_promptedit_jobsinitialize_itemlistrl_unix_word_ruboutcommand_errstrarray_subrangeshell_pgrpnohup_all_jobscurrent_prompt_stringarray_quotezreadintrrl_clear_signalsposix_initializerl_revert_linerl_reset_after_signalsh_backslash_quote_for_double_quoteshash_walksv_ifscompspec_createcopy_wordrl_numeric_argrl_dump_variableshup_on_exitmax_input_historyrestore_pipelineprog_completeskill_current_pipeline_rl_overwrite_ruboutfull_pathnameclose_buffered_streaminterrupt_immediatelybuffered_getcharrl_set_retained_killsset_pwderr_badarraysub_rl_make_prompt_for_searchrl_bind_key_in_mapstrvec_flushaddtimevalsave_pipelinedescribe_pidperform_hostname_completionextract_arithmetic_substread_builtinrl_deletereadline_echoing_prl_insert_comment_rl_init_terminal_iothis_shell_builtinfc_docmake_absoluteexit_shellmaybe_set_sigchld_trap_rl_update_finalprog_completion_enabledhistory_reeditinghistory_set_history_staterl_vi_first_printdeclare_doclcurrentrl_line_buffer_len_rl_vis_botlinthis_command_namerl_free_undo_listrl_insert_closeget_word_from_stringrl_overwrite_modeinteractive_commentsdefault_tty_job_signalscontinuingget_random_numberrl_menu_completenetopenprint_assignmentprogcomp_searchrl_display_fixedmake_subshell_commandhistory_total_bytesexit_builtinparse_and_executeabsolute_program_rl_undo_group_levelit_variablespop_scopeifs_varrl_directory_completion_hookdump_translatable_stringsget_variable_valuerun_unwind_protectsstring_rest_of_argsread_but_dont_executerl_vi_columnrl_executing_keymapunset_docrl_yankget_job_by_namemark_modified_varsrl_readline_staterl_explicit_argrl_completion_entry_functionrl_catch_signalsunclosed_pairbreak_docxtrace_print_arith_cmdtrap_list_rl_possible_meta_prefixesrl_filename_completion_desiredsubshell_environment_rl_pop_executing_macro_rl_dispatchmake_variable_valuereadline_internal_setupttgetattrtimeval_to_secsrl_vi_delete_torl_ruboutrl_noninc_forward_search_againrl_delete_horizontal_spacerl_undo_listignore_signal_rl_adjust_pointdescribe_commandexpand_wordsreset_mail_filesrl_history_search_backwardrl_donerestart_job_controlword_splitrl_variable_bindpopd_docphash_removefind_index_in_alistlist_lengthsourcelevelsh_cfreewith_input_from_streamifs_firstcrl_insert_textrl_refresh_linerl_vi_goto_markcommand_error__fini_array_endhistory_get_history_statemake_local_array_variable_rl_init_line_statetilde_expansion_preexpansion_hookit_filestype_docyyparseinitialize_job_controlcontinue_builtinset_signalrl_vi_eof_maybetest_eaccesspwd_docinit_yy_ioget_current_prompt_levellogout_builtinsh_setlinebufparse_symbolic_mode_rl_convert_meta_chars_to_asciish_nojobswhere_historysh_syntaxtabassign_array_elementmake_local_variable_rl_kill_kbd_macroclean_simple_commandtrap_docvalid_array_reference_rl_is_mbchar_matcheddispose_redirectsskipsubscriptremember_argsarray_needs_makingecho_input_at_readbrace_expansionreturn_EOF_rl_term_gotorl_on_new_line_with_promptpipeline_pgrpuitosemacs_standard_keymapmaybe_add_historysh_freemake_function_defcurrent_user_rl_input_queuedindirection_level_stringit_shoptsrl_vi_append_modereadline_top_level_rl_savestringstrlist_from_word_listset_or_show_attributessv_histignoremaybe_make_restrictedexec_doctermination_unwind_protectpush_contexthistory_getprivileged_moderl_vi_prev_wordget_hostname_listrl_restore_promptcolon_doctimes_builtinexecutable_or_directoryrl_maybe_replace_linereadonly_builtinstrip_trailing_rl_compare_charsrl_display_match_listwait_for_single_pidnum_shell_builtinstime_to_check_mail__libc_csu_finiset_dollar_vars_unchangedget_history_eventrl_set_signalsprint_simple_commanddot_doc_rl_term_icstdin_redirectsrl_maybe_save_linemake_arith_for_commandrl_noninc_forward_searchtilde_expansion_failure_hookglob_error_returnmailstatexit_docmaybe_append_historylist_optargsh_double_quotebash_history_reinitpop_var_contextsetup_async_signalssh_mktmpfpstrlist_sortshow_var_attributeshash_bucketrl_forced_update_displayrl_unbind_keyrl_clear_pending_input_rl_completion_case_foldunlink_fifo_listrl_forward_search_historystrlist_printstring_list_dollar_atexport_docbash_brace_completionsv_globignoreit_servicessource_builtinrl_noninc_reverse_search_againmake_pattern_listmake_bare_wordget_group_listread_historydisown_docterminate_stopped_jobsrl_library_versioninitialize_flagsthe_current_working_directoryrl_quoted_insertrl_copy_textbuiltin_usagerl_vi_domoverl_alphabetic_rl_term_autowrapend_job_controlrl_vi_yank_argifs_cmapwithout_job_controlreset_signal_handlersrl_gnu_readline_prl_attempted_completion_functioncurrent_readline_promptget_job_by_pidmake_redirectionfind_special_builtincopy_redirectstime_docfile_errorhistory_arg_extractrl_vi_bWordbash_add_historyskip_to_delimget_alias_valueit_runningsh_get_env_valuerl_getc_functionrestricted_shellparse_and_execute_cleanupit_signalssh_needarg_rl_vi_done_insertingexpand_word_leave_quotedhistory_word_delimitersshell_start_timestrlist_copyumask_doclocaletransrl_readline_nameset_dollar_vars_changedhistory_no_expand_charsrl_tty_statusvariable_contexttilde_initializerl_unbind_function_in_maprl_unbind_key_in_maparray_create_elementrl_transpose_charsevalexphistory_lines_in_fileparse_commandgive_terminal_totilde_expand_wordvar_lookupexecuting_line_numbersh_exittrap_builtinhelp_builtinsignal_names_rl_current_display_linekill_docsh_invalididdot_found_in_searchset_default_locale_varsrl_beginning_of_historycopy_commandstrlist_disposeindirection_levelbash_re_editlegal_number_rl_complete_mark_directoriesmake_here_documentrl_username_completion_function_rl_set_insert_modepolite_directory_format_rl_vi_textmod_commandsh_set_lines_and_columnsparse_string_to_word_listdo_assignment_no_expandcheck_window_sizethe_printed_command_rl_term_clreoltt_setnocanonrl_forwardlast_history_linehistory_quotes_inhibit_expansionbind_docsv_histsizeno_symbolic_linksbinary_testmake_group_commandrl_digit_argumentsv_tzset_shelloptsrl_backward_wordget_minus_o_optscase_docsv_pathrltty_set_default_bindingsrl_vi_back_to_indentthrow_to_top_levelsubshell_argvit_enabledassign_array_var_from_word_listsh_mktmpnamestartup_staterl_last_funcarray_disposesh_invalidoptfc_builtincdspellingbind_builtinmove_to_high_fd_rl_qsort_string_comparerl_completion_suppress_appendfd_to_buffered_streammake_cond_commandttonechartilde_additional_prefixesunbound_vars_is_errorrl_expand_promptinitialize_aliasesrl_get_keymap_by_name_rl_allow_pathname_alphabetic_charswait_builtin_rl_disable_tty_signalstest_bracket_dochostname_list_initializedrl_completearray_to_assignpop_contextsource_searches_cwd_rl_control_keypaduinttostrsv_ignoreeofbash_servicename_completion_function_rl_find_completion_wordexpand_string_unsplitrun_unwind_framehash_stringrl_completion_display_matches_hookunfreeze_jobs_listall_visible_variablesglobal_commandtrap_to_sighandlermake_until_commandexpand_word_unsplitxmbsrtowcsrl_blink_matching_parenunset_sigwinch_handlershell_is_restrictedsh_reallocfind_variable_internalmake_bare_simple_commandsh_notfoundrl_filename_quoting_desiredmake_simple_commandsignal_is_trappedrl_resize_terminalrl_char_searchsh_badopt_rl_last_c_posarray_flushsame_filerl_terminal_namehistory_listkill_all_local_variableshistory_delimiting_charsfg_percent_docprint_var_valuethis_shell_functionpatch_levelrl_arrow_keysdelete_all_jobs_rl_next_macro_keyit_bindingsbase_pathnamestrlist_resizesh_canonpathecho_command_at_executedispose_wordalias_expand_wordrl_stop_outputbuiltin_builtin_rl_print_completions_horizontallybash_readline_initializedselect_docrl_undo_commandignore_tty_job_signalscommand_substitutestrvec_strcmpreport_errorbg_docinternal_warningrl_vi_overstrikerl_save_staterl_vi_set_markrl_re_read_init_filetrue_docdollar_dollar_pidcopy_word_listuntil_docrl_backward_kill_wordinteractive_shellset_pipestatus_from_exitrl_macro_bindshell_execverl_filename_quote_charactersbash_input_fd_changedreset_mail_timerstrsubsetup_ignore_patternsword_list_remove_quoted_nullsprevious_jobget_array_valueset_itemlist_dirtypwd_builtin_rl_saved_line_for_historyget_numeric_argps1_promptunwind_protect_memrl_stuff_charthe_printed_command_sizeprogcomp_flushprogcomp_removeexecute_shell_functionsubstring_rl_term_ipsys_errorsignal_is_specialttsaverl_pending_inputerr_unboundvarstring_quote_removalyynerrssv_history_controlmake_for_commandreturn_docdo_redirections_rl_vi_reset_lastpush_scopedisown_builtinmalloc_trace_at_exitarray_patsubhistory_search_poslocal_builtindifftimevalrl_backward_bytecheck_binary_filestrvec_from_word_listexpand_string_unsplit_to_stringhashing_enabledreset_shell_flagsnohup_jobfind_token_in_alistother_token_alistrl_event_hookeof_encounteredrl_copy_keymaprl_messageprogrammable_completions_rl_mark_modified_lines_rl_strindex_rl_find_prev_mbcharlist_running_jobsexec_builtinprimary_prompt_rl_char_search_internalrl_yank_nth_argshopt_setoptwant_pending_commandbash_groupname_completion_function_rl_set_cursorlast_shell_builtinrl_set_paren_blink_timeoutcd_builtin_rl_isearch_terminatorsSBnew_var_contextrun_pending_trapssh_mktmpfdsync_buffered_stream_rl_to_upperrl_completion_mark_symlink_dirscurrent_host_namequote_globbing_charsremove_historytest_docfalse_builtinrl_redisplay_functionbrace_arg_separatorgrouping_braces_dochistory_tokenizekill_pidrl_outstreamabsolute_pathnamearray_insertterminate_current_pipelinerl_dump_macroshistory_numberreader_loopput_command_name_into_envsh_backslash_quoterl_end_of_lineexpand_words_no_vars_rl_free_match_listfind_variable_rl_enable_meta_keyrl_universal_argument_rl_complete_show_allrl_yank_poprl_vi_putjobs_m_flaghistory_searchstrvec_to_word_listfmtumaxset_debug_trapshopt_docrl_forward_bytefind_functionspnamebashline_reinitializewait_forrl_set_keyerr_readonlyadd_or_supercede_exported_varungetc_with_restartrl_reset_line_staterl_variable_dumperrl_forward_wordassign_in_envmake_while_commandstrlist_mergestring_list_internalrl_history_search_forwardlist_rest_of_argsrl_maybe_unsave_linehistory_docextract_array_assignment_list_rl_add_macro_charrl_vi_fetch_historyeval_docrl_vi_change_charclose_buffered_fdrl_discard_keymap_rl_read_mbstringstrvec_removereturn_catch_valueeof_encountered_limitrestore_token_statecommand_string_indexrl_endbreak_builtinset_sigchld_handlerquote_string_for_globbingunary_testrl_unbind_command_in_mapansic_quotedirs_doctest_builtinsh_readonlysigint_sighandlerwait_for_jobinitialize_readline_rl_get_screen_sizestream_on_stackrl_vi_change_casestrlist_flushlist_minus_o_optsread_history_rangerl_vi_append_eolmerge_temporary_envreadline_internal_charhist_last_line_addedfind_shell_builtin_rl_enable_paren_matchingstrlist_to_word_listif_docpushd_builtinprintf_docinterrupt_staterl_vi_search_againenable_hostname_completion_rl_set_mark_at_posdelete_all_contextsrl_vi_subst_rl_abort_internalttcbreakcontinue_docglobal_error_listnamed_function_stringcheck_add_historyrl_set_markprint_var_functionrl_vi_searcharray_removeminus_o_option_valuexstrmatchlist_all_jobsset_pipestatus_arraygather_here_documents_rl_to_lowercdable_varsassign_array_from_stringphash_flushprint_rlimtype_rl_lowercase_p_rl_set_screen_sizejob_slotslist_optoptbash_tilde_expandzsyncfdrl_replace_linemk_msgstrshell_namestrlist_prefix_suffixrl_completion_query_items_rl_pure_alphabeticsh_optindrl_completion_typemalloc_tracehistory_subst_char_rl_term_dcmalloc_flagsunalias_builtinwhile_docrl_push_macro_inputrl_kill_word_rl_rubout_charfind_reserved_word_rl_free_saved_history_lineexecutingset_if_notnumber_of_argssh_validfdget_tty_state_rl_bell_preferencephash_searchget_shopt_optionsrl_completion_modegetifshistory_offsetulimit_docprint_timevalpush_dollar_varsrl_start_kbd_macroreplace_history_entrylocal_docfunction_doc_rl_clear_screenrl_erase_empty_lineexecutable_filerl_make_keymapmake_funcname_visiblerl_named_function_rl_overwrite_charhistory_truncate_filerun_exit_traprl_read_keyconvert_var_to_arrayrl_byte_orientedset_langrl_vi_insert_begprogcomp_createsh_opterrarray_createrun_debug_traprl_add_funmap_entryulimit_builtinrl_copy_forward_wordemacs_ctlx_keymapsuspend_continuerl_reset_terminal_rl_screenheightdispose_fd_bitmaprl_noninc_reverse_searchrl_yank_last_argget_working_directoryhistory_search_prefixno_argsansiexpand__fini_array_startshow_shell_versionrl_insert_moderl_vi_fWordit_setoptsreturn_catch_flaggetopts_dochash_sizemake_command__libc_csu_initfd_is_bash_inputset_minus_o_optionunquoted_glob_pattern_pis_directorywait_docstrvec_lenset_var_read_onlyrl_basic_word_break_charactersmake_arith_commandrl_invoking_keyseqs_in_mapreturn_builtindequote_stringrl_restart_outputrl_do_lowercase_version_rl_clear_to_eolrl_backward_kill_line_rl_insert_typeinrl_binding_keymapsubst_assign_varlistrl_pre_input_hookrl_vi_tilde_expandplace_keywords_in_envbash_getcwd_errstrstring_to_rlimtyperl_copy_region_to_killdisallow_filename_globbingrl_ignore_completion_duplicatesrl_upcase_wordmaybe_make_export_envget_job_spec_rl_term_upmake_word_rl_backspacestart_jobnoclobberdefault_buffered_inputrl_tab_inserttypeset_doczreadrl_save_promptxtrace_print_word_list_rl_term_crsubshell_top_levelset_signal_handlerreset_shell_optionslist_stopped_jobsinitialize_trapsrl_function_dumper_rl_read_mbcharsub_append_stringrl_add_undounset_bash_inputrl_dump_functionsforced_interactivelist_opttypecommand_connectopen_buffered_streamxstrchrsh_optoptphash_creatett_setcbreak_rl_term_eimake_childdecode_signal_rl_match_hidden_filesget_locale_var_getenv_rl_term_pcno_empty_command_completionrl_backward_char__init_array_endit_disabledtest_binopset_error_trapexpand_prompt_stringprogcomp_disposedo_assignmentloptend_rl_in_streamshift_docset_dirstack_elementsh_memalignrl_execute_nextdeclare_builtinrl_complete_with_tilde_expansionrl_vi_arg_digitit_keywordsmake_command_stringhash_docexpand_stringstrvec_createwait_for_background_pidshistory_lengthrl_begin_undo_groupcurrent_builtinxbcopycomplete_builtinrl_forward_char_rl_vi_initialize_linetimeval_to_cpusv_optindsetifsrl_catch_sigwinchrl_getcread_secondary_linepush_streamredirection_expandsh_vallocrl_unix_line_discard_rl_output_some_charsttattrdisplay_signal_listrl_make_bare_keymapwlcachestrcreplaceno_invisible_varscheck_hashed_filenamesrl_completion_matchesit_directoriesremove_aliasbuffered_ungetcharfg_doc_rl_move_vertwait_signal_receivedbuild_version_rl_keymapsh_mallocrl_set_keyboard_input_timeoutrl_character_len_rl_any_typeinget_current_user_infoinitialize_bash_inputsh_getopt_restore_stateclear_unwind_protect_listdispose_command_rl_term_clrpagbuiltin_addresssh_makepathrl_capitalize_wordarith_for_docrl_set_keymapbind_functionrl_backwardinitialize_signalsrl_readline_versionget_exitstatstart_pipelineunset_builtinsh_erangecommand_builtin_rl_out_streamdelete_all_variableshistory_expansion_chartest_unopextract_process_substread_commandrl_get_termcapduplicate_buffered_streamno_optionsconnect_async_listbuiltin_errorinitialize_terminating_signalsunbind_variablealias_expandfree_buffered_streamarray_assign_listdecode_prompt_stringlast_made_pidrl_newlineset_tty_staterl_vi_bracktypedisable_priv_modett_seteightbitreset_terminating_signalsreset_parserrl_vi_end_wordstrvec_sort_rl_output_character_function_rl_screencharshistory_search_delimiter_charsget_dirstack_from_stringrl_list_funmap_namesarray_rshiftsuspend_docfind_or_make_array_variable_rl_clean_up_for_exitsetup_history_ignorebind_int_variablerl_vi_fwordrl_end_kbd_macrostrvec_copyrl_editing_modesecondary_promptrl_copy_backward_wordarray_from_word_listrl_translate_keyseqsh_un_double_quotejobs_docpush_var_contextfile_statusrl_bind_key_rl_fix_last_undo_of_typelast_asynchronous_pidasynchronous_notification_rl_meta_flagtest_commandit_aliasesprogcomp_sizesv_histcharsrl_generic_bindreap_dead_jobs_rl_erase_entire_linechange_flagcompletions_to_stringlistit_stoppedarray_shiftwhich_set_flagsttnoecho_rl_suppress_redisplaysh_neednumargecho_builtinunbind_funcrl_vi_eWordforce_append_history_rl_digit_pread_octalbash_history_enablewith_input_from_stdinrl_get_next_history_rl_bind_if_unbound_rl_doing_an_undosh_xmallocrl_vi_redomake_cond_nodeset_sigint_handlerrl_backward_char_searchunstifle_historysuspend_builtinrl_delete_or_show_completions_rl_screenwidthrl_parse_and_bindset_login_shellstrlist_walkrun_trap_cleanupdispose_saved_dollar_varsstring_list_dollar_starjump_to_top_levelchar_is_quotedreadline_internal_teardownttrestoreliteral_historycurrent_command_line_count_rl_find_next_mbcharrl_special_prefixescount_all_jobsdispose_wordshist_verifyfind_tempenv_variableshell_glob_filenamereadonly_docread_from_stdinrl_downcase_wordnew_fd_bitmapemacs_meta_keymapit_arrayvarsrun_error_trapgetmaxchildmake_case_commandrl_vi_undorl_vi_bword_rl_input_availablehash_disposeprint_commandall_exported_variablestilde_additional_suffixesrl_initializeshopt_listopteval_builtinmaybe_call_trap_handlerfmtulongexec_redirection_undo_listkill_builtincd_docarray_variable_partset_var_attributeshell_ttylocal_exported_variablestimes_docstupidly_hack_special_variablescurrent_historycurrent_readline_linerl_vi_change_torl_vi_deletegetopts_builtin_rl_possible_control_prefixesrl_prep_terminaladd_aliasdump_po_stringsexecute_commandremove_unwind_protect_rl_horizontal_scroll_modeparse_shelloptscompgen_docrl_add_defunnoglob_dot_filenamesexecute_command_internalglobal_variablesremove_backslashesget_group_arraystrlist_removearray_walklet_builtinrl_completion_append_characterunalias_docremember_on_historylet_doccommand_docinitialize_job_signalswait_intr_bufrl_kill_full_lineEOF_Reachedrl_vi_next_word_rl_set_the_lineoptflagsenable_builtinfind_aliascomplete_docwith_input_from_stringps2_promptinitialize_shell_optionsclose_fd_bitmaprl_vi_overstrike_deleterl_invoking_keyseqsrl_on_new_lineclear_hostname_listadd_unwind_protectrl_extend_line_bufferzwriterunning_trapstdin_redirthe_current_maintaineryy_input_namefalse_docit_hostnamesrl_attempted_completion_over_rl_redisplay_after_sigwinchcmd_initset_default_localerl_vi_char_searchsh_realpathtop_level_maskrl_transpose_wordsrl_get_previous_historyrl_num_chars_to_readhistory_builtinlist_one_jobprint_array_assignmentrun_interrupt_trapmakunboundrl_do_undoget_string_valueall_variables_matching_prefix_rl_term_imit_exportsrl_vi_movement_moderl_cleanup_after_signalvariable_help_docarray_variable_nameget_name_for_errorsave_bash_inputrl_get_keymap_name_from_edit_modemake_word_listmake_if_commandrl_beg_of_linerl_prep_term_functionrl_possible_completionswordexp_onlyansicstrsh_single_quotepushd_doctrap_line_numberrl_set_promptsh_invalidnumclean_itemlistyylval_rl_parsing_conditionalized_outfind_path_fileisnetconnalready_making_childrenrl_insert_completionsrl_complete_internalifs_valuerestore_original_signalssv_terminalumask_builtin_rl_push_executing_macrorl_get_keymapsv_mailprogcomp_walk_rl_eof_charsubshell_argcgen_compspec_completionsit_userscleanup_the_pipelineprompt_string_pointerrl_basic_quote_charactersdelete_job_rl_page_completionsrl_function_of_keyseqstrlist_createprint_shift_error__init_array_startsv_hostfilerl_kill_regionfunmap_program_specific_entry_startrl_vi_editing_moderl_tty_set_default_bindingsset_buffered_streamrl_exchange_point_and_markenable_docreset_shopt_optionsrl_abortcurrent_readline_line_indexalias_expand_all_IO_stdin_used__libc_ia64_register_backing_store_basesh_badpiddist_versionget_directory_stackprint_func_list_rl_term_ICdispose_used_env_varsshould_ignore_glob_matchesposixly_correctunbind_argsrl_visible_prompt_lengthexport_builtinit_functionspushed_string_listfatal_error_rl_replace_text_rl_last_command_was_killinitialize_shell_builtins_rl_comment_beginrl_pointsh_get_home_dirlist_reversedelete_all_aliasesassign_array_var_from_stringinternal_errorall_shell_functionscond_expand_wordconditional_dochistory_is_stifledredirection_errorpat_substrl_tilde_expandprintf_builtinbind_keyseq_to_unix_commandsh_xfreelast_command_exit_valuesv_opterr_rl_term_backspaceadjust_shell_levelcommand_word_completion_functiongetmaxgroupsrl_insertrl_promptrestore_default_signalmake_word_from_tokensh_xreallocposix_readline_initializerl_initialize_funmapcompspec_copyhistory_inhibit_expansion_functionno_exit_on_failed_execsh_contains_shell_metasrl_deprep_terminalcurrent_command_first_line_savedset_working_directory__data_startword_token_alisthangup_all_jobsrl_inhibit_completion_rl_last_v_posit_builtinsshow_name_attributesrl_clear_messagerl_get_keymap_namerl_vi_insertion_modehash_copystop_pipelinecopy_redirectcheck_dev_tty_rl_start_using_historyzresetmake_new_array_variable_rl_history_preserve_pointjobs_builtinarray_copy_rl_fix_pointtteightbitstrvec_resizefree_mail_filesecho_docbuiltin_address_internalrl_delete_textextract_command_substglob_ignore_caserl_free_line_statesplit_at_delimsphash_insert_rl_move_cursor_relativecheck_bash_inputdispose_exec_redirects_rl_insert_charparse_and_execute_levelmail_warningsource_uses_pathcommand_oriented_historyrl_end_of_historyall_digits_rl_init_eightbitsignal_namerl_replace_from_history_rl_uppercase_prelease_statusgetopts_reset_rl_term_DCsh_invalidoptnamerl_visible_statsrl_emacs_editing_modemap_overpop_dollar_varsbind_var_to_intnotify_and_cleanup_rl_enable_keypaddispose_var_contextrl_startup_hookdispose_cond_nodestrvec_disposeunbind_array_elementreset_internal_getoptmalloc_registeryycharit_commandspop_streamclear_historydont_save_function_defsquote_escapesfc_execute_fileexpand_aliasesdispose_variableshell_initializedprogramming_errorrl_char_is_quoted_ploop_levelmap_over_funcslong_args_rl_init_argumenthistory_basesh_callocsh_physpathyyerrorbash_initialize_historypopd_builtinGLIBC_2.1GLIBC_2.0GLIBC_2.3GLIBC_2.20ii jii kii  kii k`G `G(`G`G`G`GA`G`G``G `G0`G@`GP`G``Gp`G `G0`G`G/`G/`G/`G`G`G`Gf`G*`G*`G*@`GP`GO`G`G`G`GH`Gx`G`GV`G`G8`Gh`Gd`G Y`G `G`G(`G3X`G^`G`GHY`G`G`GJX`GJH`G? W`G?x`GHW`G`G`G#`G8`Gh`G^`G`GY`G`G.(`GPY`GX`G`G`GhX`Gh`G%X`G%`GH`G`Y`G`x`GpW`G`G`G `G W`G 8`Gth`G`G`G`G](`GX`G@`G+`GW`G`G`G`G%`G4H`G}x`G`G:`G`Gx`GK`GK`GK`GK !`GK`G  `G P`G P!`G !`G `1`G 1`G Y`G `G `G50`G`G0!`G0'`GX`G@`Gk`Gkp`Gk0&`Gk@1`Gk8`Gk8W`GkP`Gm`Gm``G`G`Gp`G`G`GhP`Gh`G`G#`GxY`G`G`G`G`G`GP`G`Gr``Gr`G@`Gp!`G`G`G@`GP1`GW`G`G>`GA `G|0`G`G@`GuP`GmP`Gm``G``G`G`G`G`G`G`G`G`G`G `GW`Gp`Gk`Gk`Gk`Gk`Gk`Gk`Gk`Gk`Gk `Gk0`Gk@`GkP`Gk``Gkp`Gk`Gk`Gk`Gk`Gk`Gk`Gk`Gk`Gk`Gk`Gk `Gk0`Gk`Gk`Gk`Gk`Gk`Gk`Gk`Gk `Gk0`Gk@`GkP`Gk``Gkp`Gk`Gk`Gk`Gk`Gk`Gk`Gk`Gk`Gk`Gk`Gk `Gk0`Gk@`GkX`Gk`GP`G`G`Gp`G`G!`G`G70`G7`Gp`G`Gv`Gv"`Gv X`Gv`GG `GG`Gl `G0`G`G"`Gp'`GX`G@`G`G!`G1`GW`GP`G`G``Gu@W`Gup`GPX`G`G`G"`G`G&0`G&`G`G0`G`!`G`GB`G`G`G7W`G7`Gi``Gi!`Gi`#`GiP'`Gi Y`Gi`Gp`G`GI`GI `Gl0`G @`G1P`G``G`G``G`G!`G#`G`'`GhY`Gp`G`G`G!`G"`G 2`GW`G`G`G`G`G`G!`G1`GV`G`G`G`G&`G`G`G`G`G`G`G`G`G`G`G`G `G0`G@`GP`G``Gp`G`G`G`G`G`G`G`G`G`G`G `G0`G@`GP`G``Gp`G`G`G`G`G`G`G`G`G`G`G `G0`G@`GP`G``Gp`G`G`G`G`G`G`G`G`G`G`G `G0`G@`GP`G``Gp`G`G`G`G`G`G`G`G`G`G`G `G0`G@`GP`G``Gp`G`G`G`G`G`G`G`G`G`G`G `G0`G@`GP`G``G`G`G`G`G`G`G`G`G`G`G `G0`G@`GP`G``Gp`G`G`G`G`G`G`G`G`G`G`G `G0`G@`GP`G``Gp`G`G`G`G`G`G`G`G`G`G`G `G0`G@`GP`G``Gp`G`G`G`G`G`G`G`G`G`G`G `G0`G@`GP`G``Gp`G`G`G`G`G`G`G`G`G`G`G `G0`G@`GP`G``Gp`G`G`G`G`G`G`G`G`G`G`G `G0`G@`GP`G``Gp`G`G`G`G`G`G`G`G`G`G`G `G0`G@`GP`G``Gp`G`G`G`G`G`G`G`G`G`G`G `G0`G@`GP`G``Gp`G0`G0`G0`G1`G 1`G01`Gp1`G1`G1`G1`G1`G1`G@2`G`2`G2`G2`G2`G2`G2`G2`G2`G3`G3`G 3`G03`G@3`GP3`G`3`Gp3`G3`G3`G3`G3`G3`G3`G3`G3`G4`G4`G 4`G04`G@4`GP4`G`4`Gp4`G4`G4`G4`G4`G4`G4`G4`G4`G5`G5`G 5`G05`G@5`GP5`G`5`Gp5`G5`G5`G5`G5`G5`G5`G5`G5`G6`G6`G 6`G06`G@6`GP6`G`6`Gp6`G6`G6`G6`G6`G6`G6`G6`G6`G7`G7`G 7`G07`G@7`GP7`G`7`Gp7`G7`G7`G7`G7`G7`G7`G7`G7`G8`G8`G 8`G08`G@8`GP8`G`8`Gp8`G8`G8`G8`G8`G8`G8`G8`G9`G9`G 9`G09`G@9`GP9`G`9`Gp9`G9`G9`G9`G9`G9`G9`G9`G9`G:`G:`G :`G0:`G@:`GP:`G`:`Gp:`G:`G:`G:`G:`G:`G:`G:`G:`G;`G;`G ;`G0;`G@;`GP;`G`;`Gp;`G;`G;`G;`G;`G;`G;`G;`G;`G<`G<`G <`G0<`G@<`GP<`G`<`Gp<`G<`G<`G<`G<`G<`G<`G<`G<`G=`G=`G =`G0=`G@=`GP=`G`=`Gp=`G=`G=`G=`G=`G=`G=`G=`G=`G>`G>`G >`G0>`G@>`GP>`G`>`Gp>`G>`G>`G>`G>`G>`G>`G>`G>`G?`G?`G ?`G0?`G@?`GP?`G`?`Gp?`G?`G?`G?`G?`G?`G?`G?`G?`G@`G@`G @`G0@`G@@`GP@`G`@`Gp@`G@`G@`G@`G@`GY`G`G`G`G`G' `G'`G `G`G|`G|p`G|`GQ`GQ!`GQ2`GQ `G`G0`GJ@`Gp`G`GP`G{(X`G{``G`G"`G2`GX`Gp`G`G "`G02`GV`G`G`G`GR`GR@"`GRP2`GR0W`GR`GKp`GK`GKxX`GK`GN `GN`G~ `G~0X`G~`G$`G`G&`G`G#`G#`G#`G#`G$`G$`G $`G0$`G@$`G`G`G2 `G0`G(`G@`G'`GP`G$`G&`G``Gp#`G`$`G%`G%`G'`G'`Gp`GNp(`GN`G=P#`G=$`G=p&`G=`G0(`G`Gj$`Gj&`Gj`Ga`GD0`GD``GD`G)%`G)'`G)`G `G1`G`G`GT`G %`G `G%&`G%0`G6@`G&`GP`G9@%`G9``G@'`Gp`Gg#`Gg`Gp2`GpY`G`G &`G (`G`GX`G`G`Y`G`G$`G&`G`G%`G'`G`Gn#`Gn`G%`G`G#`G$`G`G%`G'`G `G'`G0`G%`G'`G@`Gv#`GvP`G#&`G#``G<@&`G<@(`G<"`G(`G2`GhV`'pV`'OxV`'ZV`'6V`'V`'V`'dV`GuV`GwV`GV`GV`GV`G,V`G_V`GsV`G{V`GГ`GW`GW`G W`G.(W`GEXW`G`W`GhW`GxW`GW`G W`GqW`G|W`GW`GW`GW`GW`GW`GW`GX`GQ8X`G@X`GHX`GXX`G`X`GhX`GCpX`GHX`GNX`G]X`GX`GX`GX`GX`GX`G`GX`GX`GX`GY`GY`G+(Y`G0Y`G8Y`G@Y`GXY`GY`GqY`GY`G`G`G@`G``&`' `H0`T@`XP````pp`v`````Є````` `0`@`P``` p```(`)`:`UЅ`^`s`}`` `0`@`P```p``````І``` `0`K `\0``@`cP```p``````Ї` `0`7`C`R `]0`e@`tP`}``p``````Ј````` `0`@`P```p````` `Љ`<`E`J`M`V `Z0`[@`rP`t``yp`z`````Њ`````  `0`@`!P`9``Ip`R`]`b`l`p`yЋ`{```` `0`@`P```p``````Ќ`-`0`2`5`J `S0`X@`_P`c``ip`s`t`u`w``Ѝ````` `0`@`P```p`` 0B `?# `@!U  !H A80(``x$Hx$Hx$Hx $Hx$Hx$Hx$pHx$`Hx $PHx$$@Hx($0Hx,$ Hx0$Hx4$Hx8$Hx<$Hx@$HxD$HxH$HxL$HxP$HxT$HxX$pHx\$`Hx`$PHxd$@Hxh$0Hxl$ Hxp$Hxt$Hxx$Hx|$Hx$Hx$Hx$Hx$Hx$Hx$Hx$pHx$`Hx$PHx$@Hx$0Hx$ Hx$Hx$Hx$Hx$Hx$Hx$Hx$Hx$Hx$Hx$Hx$pHx$`Hx$PHx$@Hx$0Hx$ Hx$Hx$Hx$Hx$Hx$Hx$Hx$Hx $Hx$Hx$Hx$pHx$`Hx $PHx$$@Hx($0Hx,$ Hx0$Hx4$Hx8$Hx<$Hx@$HxD$HxH$HxL$HxP$HxT$HxX$pHx\$`Hx`$PHxd$@Hxh$0Hxl$ Hxp$Hxt$Hxx$Hx|$Hx$Hx$Hx$Hx$Hx$Hx$Hx$pHx$`Hx$PHx$@Hx$0Hx$ Hx$Hx$Hx$Hx$Hx$Hx$Hx$Hx$Hx$Hx$Hx$pHx$`Hx$PHx$@Hx$0Hx$ Hx$Hx$Hx$Hx$Hx$Hx$Hx$Hx $Hx$Hx$Hx$pHx$`Hx $PHx$$@Hx($0Hx,$ Hx0$Hx4$Hx8$Hx<$Hx@$HxD$HxH$HxL$HxP$HxT$HxX$pHx\$`Hx`$PHxd$@Hxh$0Hxl$ Hxp$Hxt$Hxx$Hx|$Hx$Hx$Hx$Hx$Hx$Hx$Hx$pHx$`Hx$PHx$@H x[$A<0(`` x[$A<0(`` x[$A<0(`` x@[$A<0(`` x[$A<0(`` x[$A<0(`` x\$A<0(`` x@\$A<0(`` x\$A<0(`` x\$A<0(`` x\$A<0(`` x@\$A<0(`` x\$A<0(`` x\$A<0(`` x]$A<0(`` x@]$A<0(`` x]$A<0(`` x]$A<0(`` x]$A<0(`` x@]$A<0(`` x]$A<0(`` x]$A<0(`` x^$A<0(`` x@^$A<0(`` x^$A<0(`` x^$A<0(`` x^$A<0(`` x@^$A<0(`` x^$A<0(`` x^$A<0(`` x_$A<0(`` x@_$A<0(`` x_$A<0(`` x_$A<0(`` x_$A<0(`` x@_$A<0(`` x_$A<0(`` x_$A<0(`` x`$A<0(`` x@`$A<0(`` x`$A<0(`` x`$A<0(`` x`$A<0(`` x@`$A<0(`` x`$A<0(`` x`$A<0(`` xa$A<0(`` x@a$A<0(`` xa$A<0(`` xa$A<0(`` xa$A<0(`` x@a$A<0(`` xa$A<0(`` xa$A<0(`` xb$A<0(`` x@b$A<0(`` xb$A<0(`` xb$A<0(`` xb$A<0(`` x@b$A<0(`` xb$A<0(`` xb$A<0(`` xc$A<0(`` x@c$A<0(`` xc$A<0(`` xc$A<0(`` xc$A<0(`` x@c$A<0(`` xc$A<0(`` xc$A<0(`` xd$A<0(`` x@d$A<0(`` xd$A<0(`` xd$A<0(`` xd$A<0(`` x@d$A<0(`` xd$A<0(`` xd$A<0(`` xe$A<0(`` x@e$A<0(`` xe$A<0(`` xe$A<0(`` xe$A<0(`` x@e$A<0(`` xe$A<0(`` xe$A<0(`` xf$A<0(`` x@f$A<0(`` xf$A<0(`` xf$A<0(`` xf$A<0(`` x@f$A<0(`` xf$A<0(`` xf$A<0(`` xg$A<0(`` x@g$A<0(`` xg$A<0(`` xg$A<0(`` xg$A<0(`` x@g$A<0(`` xg$A<0(`` xg$A<0(`` xh$A<0(`` x@h$A<0(`` xh$A<0(`` xh$A<0(`` xh$A<0(`` x@h$A<0(`` xh$A<0(`` xh$A<0(`` xi$A<0(`` x@i$A<0(`` xi$A<0(`` xi$A<0(`` xi$A<0(`` x@i$A<0(`` xi$A<0(`` xi$A<0(`` xj$A<0(`` x@j$A<0(`` xj$A<0(`` xj$A<0(`` xj$A<0(`` x@j$A<0(`` xj$A<0(`` xj$A<0(`` xk$A<0(`` x@k$A<0(`` xk$A<0(`` xk$A<0(`` xk$A<0(`` x@k$A<0(`` xk$A<0(`` xk$A<0(`` xl$A<0(`` x@l$A<0(`` xl$A<0(`` xl$A<0(`` xl$A<0(`` x@l$A<0(`` xl$A<0(`` xl$A<0(`` xm$A<0(`` x@m$A<0(`` xm$A<0(`` xm$A<0(`` xm$A<0(`` x@m$A<0(`` xm$A<0(`` xm$A<0(`` xn$A<0(`` x@n$A<0(`` xn$A<0(`` xn$A<0(`` xn$A<0(`` x@n$A<0(`` xn$A<0(`` xn$A<0(`` xo$A<0(`` x@o$A<0(`` xo$A<0(`` xo$A<0(`` xo$A<0(`` x@o$A<0(`` xo$A<0(`` xo$A<0(`` xp$A<0(`` x@p$A<0(`` xp$A<0(`` xp$A<0(``EL ``A!` @l !DDD  P*H @aX$H`  0 F@0 (P BX  @H !bp 090CXD!U BH !0@ <@A@0( `h x@y@x B  8UH ! `o p$0@ p0 0@4` PF!H0)H p$0HpB 89@H@Bp 89 BpD 89PBpF 89H0Bp 09`C pB`8s !CpDB 09 q$pB q$ 89PB x0}$@ x8Bx8 Cx$pB 89H0Bp 090BpD 89Bp@Hpp}$pB pp8 sp !PBp 89H0B x<B89x8 C0UP pB BHp !`J@!8]P !B@H p@p8 spBBpD 09 B89C}$pF 89@H0Bp 89CpFt$`8sPB p !8 89H0B x<B89x8 C@H!\PN!0UP @!G$ H@P: PN! H`D @AG$ @P 09`B9 P89BJ@aG$ H@P9 P89BJ@G$ H@PX9 PN!Hp`q$ H@(9 PN!H }$`H p < p!p< s8 J@!G$ H@P8 PN! H`D @AG$ @P 09`Bh8 P89BpJ@aG$ H@P88 P89B@J@G$ H@P8 PN!H `$@0 @X@!B8, PN!p J xPs$<Bp 01PJp`q$ H@h7 P H @G$0 HP@!B(XH @G$0 P!B`(H H̑!@B p!U p 0![PpB@ x!PHpP(Jp; 0C@!U XX89Bx$H0B  @!XZPF!@ B̑ ! 89HC ( 8( w0C@@U xX89BJ G$@0 P F!@BH HP F!@H P F!H P p$B 8@ @@ 0-pBXN!0 BW !@BpD 0 8C@H 0P9C aD!0 0P9PC D!0 0P9C@0#H !D!"B DXN!@ #X @BXxDB p@@ #888@C$@ !0UP pH 8 8JHpG$HHțPN!HpG$HHPN!HpG$HHhPN!PH M  ! b !BB(@8XH!P (Xx@! p0@U 8 #p2xF@f`<#HH"P09`AHB!B`XN!HB!B`H;PN! B@% X$ bH @ DX N!H̑ p`8sp!B0@9Cp 89CHF!B`(hP@B!B 0UP `!xs$`s p!8 89J PN!B@ X $؄P@B!B 0UP `!8XpB@@89CPHXB 8GPN!p s#H$(XHB!BXHB!B 8XXN!B@ DZHP@B!B 0UP `!HF!>P89BJH@! XP09B PH! DbHK!PN!B@X!B @pHhX H@N!3BXp!B@x%@C px8@ 8<CHRpCXB EPN!HHH!H$BHRIPHH xq$0B   89 0B HX !B83P F! xq$`8s0Bp 89Cp%@bH!"J (! 89@B HP0 8PF!U  P@0 h`PF!U h]PF!U  bHH@9`s@BpB 880pC(BxPH!O ( HXX\!8\G9,r B pVpP89 C$BX09@0CxV!أX\!pT 890CpP 89 CxV!@!8f PHxA$B Vd@!}P\!@ B`x! Cpu$H <x!@B `80 ءX\!`H p&8B A^!0 89 CxB BhXx!B0$|PBB@HXH.P\! B@,Hx@q$ B p!80 h9P !B@Xx!B0${Px!B 0Hx $B &h{P8G9B@p$p C8G9 pl$P C8G9  CpH!@!Hx $B d{P\!@ B đ xH!8B p `8sp(hH 8@  8QHpH!<#pH x`$<0 xXx!BxX09B@pO$ 0Ch7P!BxB! BXx!B hL! ByPx!B0Hx!!ȠXx!!BxX\!p # <! xB0 C 8GC#cbC 8PG#cbC 8G#cbC8G9 !0Cp!B@8Xx!B VdH!B 6xB!8Xp!B pP!B5L!2H(xPp! B x$ps p !pB<p w@#xCp@0Bu8 pp`C@!0 B 0G9@C p@:~F8 ppJ@!Hx $B hwPpTB @ ! 89@B pPp8 sp& x!PB p&8B p^!8  0H8Bp^!B  pp8 sp H8B@!`Hq$ Bp ! xHXP`Hx $B vhuPx!p؎ s \!@ ؀$p<+H @! 8(wJ @!1BBHX\!1BBX!BXx !B0=$tPx@B @ !xP89 89PC @!x+ x@xP89 89JB1B@ xH  $BxP898(  Q8H8@#X\!B0m$uPpTBpp! 0CpP 89@CxB!H xp$<BxBXx!B0$8sPx!BBȘX !BJx!sHؚX!B@JHxV!1P!BpH 8C B@xpx8+ Ht$ B@ p !80 ؗXH(X\! HxV! BxXx!B0$qPx!BXH p!8 8(ppJ89J p!8 8(p%Hp4$8HHX!@HXX89BXp H8V0JHX!BHO$1B@@ $BbxX\!HxB! BءXx!B Fd@H0B !bPD!(}X@!B`Bg!@B (!hP09B0CU x&@B(!P09J p`~$8 x=#HPxJpx)p pp<@`p`@!PH x %<B  0H9 J (O$P0 hpPF!H x %<B  0H9JHsPH x %<B  Y PpH p %8B @ 0H90J H(XF!`6H@ xM$P<0 hmPp@B@(XH0-0Bp~$HPb <0 @@9,B p 8 8(p B A?#s,`C p 8 8(rP(9 0$ǹ%J@! O$0 Y@B@ A?#0 @@9,C p 8 8(pH!Jx P89J0@8,pC p 8 8(r@(9 0$ǹ0C@!0@8,J8F9 B8@9@B0F9BPBH@!BP !B@H!0UP pM$H@%pHjPx!,@ N!9@ 0UP  pp<+! H  ! b(@XH!p 8H@ xM$<0 0B!iP (!0@BX!B@HX09 , @C p ;~F ppP0(9pCpq$`H(`0 6PH!PB8$jPH!U  @?#` s@X p ;~FK ppP0(9Jpq$`H(`0 X5PH!PB8$HjPH!U ! H@ !`r@8@!C0LP8 4P H!`Hp!Hp 090B p`8sp0$U x!H8 p`~$P8 đ0J90Bp 89C p~$80 090B ppP09Caq$`H pB`0  0@H 4<0 Ađ8@!P8 x3PH!U p!8 09J pB`8s @B8B!8XH! B@8!Kpq$`H(`0 2PH!PB4p pM$`80 gPH! xp$<Bp 89J8XH!H8XH! B@8!Kpq$`H(`0 1PH!PBTppM$ 0 H`H 1r$0B p!8  0H8H@B p`8sȑ8 09HC x 880HB xp$@80 p!H(8  H`8spPH0a80 ȔX F! q$H x!U 8 pD #$x #HpXF!@BPF!U i00Bp`$`HPb !0<Bh Pn! HA ̑pP$H@ Hq$`<B(!  hd pJ xDXn!H B!HJ # Lp #BX n!J(8!$H  <BA!!(qX88B p=# N!`CH5pP CCD8P!BpX88BFF! N!8C8(9J p@8 8(pp $ !J p($p #hDXn!x # hP #Pp #dB x0$<B p!8 8 p< s@A xq$<B p`8s$ A $"PpR   B`9@ p?#p #Xn!`rB0CHPn! p $08BF! p($p #BXn!x # hP #Pp #dK0F90CpF 090C@F!UP F!xPn!UP `EH q$JD~$H Pa~$PHH  <B`8F` 8P0#Hp!8mX89CxB!H#zFH5pP sCpD4P!BlXp=#B89JpF@*Ip!C FHp C0B9HC8PpCpB 09@CpB!aP!BhPZ!0@9BpC0D9 C pDpP09BXZ! @@D!`U  p$@ #888pCXZ!`r0CpB!xPZ! $0  !`r@PJpM$~C x  `rpX@< PBp@p@?# B@D0@98,p@@C x@>~FxP098  CH$5J0"9 @ x@H! 3~FDb ! bLLфen088`~F p v papRx8 p8 r@x 8B{B T 8B8DH % 0b8@9`C@!pX@BB@Y00pCp `s0B ppP 8 B8P!,! ppP89 89PC @P!@Y p@ 8 8(p89JBp8 qBp@ ` H ppP 0B58BH8=PJ! #@0D!{PJ! U0 @! U0  !bxP89`C<(rC p@?#p@8$5<(`C89 89BB p:~F8 pB @!uP09BC!@ B(nXF!`z H@ pY$P80 h<P !BaXF!U @!U  p@!8 8(p Y$ HJXiPH p@!8 8(pPJ Y$  HH@H `$:H`b !@   x8B <"8 p8  C PF! B4p|$H d $8B@@<0  "90+ x80#$ PF! B@Ap|$H !H "80  p<0+H0# p@pPx!`8sr`9>sqz$C09C09@@C @! 8(p@98Br(!PC `9`8=s@},@1 C@H@!@$ % Bp|$H(!0b!Hx" 8B <   8D 8(wC0@!` s@B PJ! #@iXJ! H@ pY$p80 7P0!BX]XJ! #@XJ!0H(1 bH0!@b@D 89CpY$H` X$B @XPJ"@@B #7PH!B@D@0#VX89B@ FMWxB8Bˈ@DBpp< 8FM xFx!C B@8BxH,Dp 888PB`@H,Dp 8880C$! 0H 0Jp@ 88$8@CB@DB@ x@ 0<8C@ 0&1`CH,Dp 8<80C$! 0H&0J p@p8 aBH,#p8 @ <D 8 (Up   P DB@HpD 8H0H,Jp?#`H`C BH,@ p8  ;~Fx <H p "!0  pp< # p@8B8@ H  M`!$PB x!@<Bp 08@8`<BCp 08@8CpD 89C 0H݈D ЀPC<,xp8  xDap 88@!J@! U0 @$ U0 XJ! @H8)PBH @!`b@J 09PB 0@@Hpp #8U`  !$ 8R9C0R1 C PpHB J0HppCpF,@ p 8 ( P pJ @ `=a BJ 0@90 ppH08@XXP! H0@9B@H %  H (!0b@D 09PB 0@@Hpp # U0  !$` 8L9CxY$`C@$`,dD8/PpBB D 01pC@, p8 pD@@ xx8 #pB 0@0J 0@90 @pB8@XJ!` H0@9B@H % `H$Hꃛ(!0b @8B8@!X.PJ!`B @ BM @)$8 # B<B.PJ! U p0@! @ @8 #@ % HpK$ H0b@M x!a<B p"p8 cwxD X$p<$@Cp@pB @q$pP09B^X0!B8D!,P0!BhRXp B! BB U0 0$h,Pp B!@0# ( U(,P!BH@93~F@ !0B PB!PBBh]XpD B@ !C ppP09B@09C09CHUX85BcC, !0C pD 8 8(pr@C01`J0p9pK09`J pJ8\@8JTX85BcPJhA!`1BEXD B pZp0#QXp!BppL0cp<0#Y!`phJ@@!@Up `!pJ p.  H  b (@!BXH! B0XH 3~Fa !@8B  8#hXF!U `@!! PHTpK$ bU 0M x!a<B p"p8 cwxD Xp8  @0C p !!0#((Pp !B0! PH4 pK$@B@0'P@! BB@ H!! #0@ # " #0-H@%pK$Pb@!@BdHH'Pp`!@ BA N! B`=0#P    H 0-H@%pK$Pb B!80 &Pp ! BAN! B`  90#P  A0#xH B D!B! <B8H B D!*H! <BH  B 0@9 b@Cp@@B8(p0CU X!B0(H XAB8!H0B!B@ !P80  p@80  xBxP09 0$9@C B! <(r0$9JhB!<(p89@C B! 8(p89J8B4 !C H! 0H9C0H1pB0H9C0F9B0CpJ!BH8%PX! pBpP89 B!JpK$`Ch$Hp"Pp!B @!!p r8  C\@<@Bx< p.p< #x!! I xDB Bb !8 p `<sw<  8)8" C 0 Ip! PC x!< 090B 0@! !@ 0 9PC@@!1Bd @8t0( `80t0(  @8Pt) U0@8pt) |H*p0( P@:p0(p@:P@ x@8t0(`80u9P 8Pu9 8u9 80u9 8Pu9 8pu9 8u9 Ѐ8u9 8u98t1f $B`P`!` sABX `!0 BH p@@!80 h3P`!B @ I p!@8 #P`! HqP`! Hp@ %H!X`!` s  Ip! J!0Ba'O D hX`! BpH!P`!` sJ 0$DBP`! B`H p@@!80 1P`!p s#$0 HX`! `H !D  0"xX i*3zF@!0B b(!@f J!XE$B(Xf!PBXf!`BR!Xp@B008)p0CpL 89CP90L90BxL< p .p< #L!`BH!pBX(!B D!0CXXf!R!PHXf!B a p`L!80 098BKp 09JP*$HXA$Hax!H! HXX8 0B@ @ p@!P 8Xf!PBXf!P0 h*Pp@Bq0 0L9 KpL 89BKp 098BKp 09KA!XX8 00C x@!P @"L ppp aѨ!!X(!!p B  HP0 JP@!0  T@ 8,p(P f!\`B)P f!Z`B)Pf!`B 0CV)Pf!(Q!"s V˜BJX)P f!X`B8)Pf!`B aL!0  p !80  0 8Bp@8\@8p@`BJBpXf! JD!XXf!H *$P0 hYPf!Pf!Pf!H @ x !p< #LPf!HH@AP€B @!f pb JD x` !08)pp 09C01B09 C09CpJTH% p!8B XV8 \PR!HHOPp=# 05J0B9`C pJB8B xV0  0 <Bp@8\@8XR! B D p!8 09 C J@BxHxpx$ 8@90B088 8@9Bp@ !`s@B p`8rx< p .p< # pJ8BXXR! B@@!W8p !"s @ XPd"BX2V! @!K+rLP@8\@(8L<B xL8  x8 p@ s БPH!U (XH!H()@H 0!@b p!8  8H!0C 8D 8(rC89@B pN!8 8(rC8DaP!B@8!CؼXL! B H$@H@PL!@B!(U@ p@q$M !0  ppP09<BK a!0 89C8@/X8!B p A$p B@P@@B@x#X !BP@B! XL!pH8D8]PL!` C x&<B a!0 89C8@.X8!B EH.X8!B Ex A$p B@P8!B@DH 8AD$p0 (*P09B`C!p B-X L!8D ,-XL!HB p A$80 P!B8!!X@D @ 08@! B!X H 8AD$p0 H)P@!B8D8XpDB@ ppP89pC@!HXXL!H8D,X8!B E H8!HؙP89B @p AqB#@J`H ! 3~F 0aD$PB`0L(P09B0C ppP090C !0#pDH p$p8 aB CBpp CB0BL,apB Ms8@ @pL0B0'1Bp)xp)x p8  QttR p8$ p8"@s x< pD+ xL =B<"0aD$p0B0L7P@!B ̑ p8\@8H8 U0 `!p$0B 8AQq)d08&0L,pJ 8<`p1R 0L `t pthR p8 p8"@s x< pD+1a x< < @<,RPF!U  P0 xXF!@BhPF!@RHHXH(@(XF!@B(PH%  H !@!PfB9 b p!`0 8L8!@Cp 89pCC pD$p0 0hXH!/0P09BJ@!pB0@xPH! B@ pD$`80 XH!`B x A$p<0 xP0H0@P09BJ0@PH! B@ pD$`80 (XH!`B`H@Bx @! @!b` p@`pP0Bp (!`80CU XF!P B H XF!U @@!@@! !  I (!0b8D!X89BD XJ! x! U@$p ! < % `B (!0b@X X J!I p !`<0  p@8 @0 ePJ! B pD@H 0!`8r@8PCx@! D< p@.  8HPx@!B (D U0  p8\@8! `BH ! b0LhP0!!B@9PC $`0 X89BBp E$@B0Pt 0 8#PH!!BAp1$NH_ U  p<0 8 xD0#x`sApb 0pp1 `t  H !)x$H90#% `B@!@B@ (B!X(!BX@@!B0 I !b p!8 09pC$Xx@B@JU as$XXF! , @!@ X BXF!@H % PB` !@!XJ!` ,  aPJ!  B pB@H 0!`8r@8PCx@! B< p@.  88Px@!B (B U0  p8\@8 3~F@0B9@B0A!0C pBpP09`Cq$0Bx !0B @ 8U `@!XH!p J @@!Hx !0B p p< #0a % PB` !@!)XJ!` ,^PJ!  B pB@H 0!`8r@8 CBHP@@!B@B % PB` !@!oPJ!` ,(^PJ!  Bu pB@H 0!`8r@8 CBP@@!B@B % p H` (!B(P@@!B@(!`B !@!8P!B@ P!B8DHPL!pBx!X@@!BPD H !b @@B P09B0CU PF! B Bp.$xH p<0 8 xD0#H()3~F a$`BpD 890C@@!(U@ `@!8A!BHXp @!0B 0 D080 p 01KxD, B!8BxHHPx@!Bp 00J@@!(U@ `@!H !b @@BP09B0CU P!B `!A$H`B x"p<@ <"@0  pxL0#8$H()zH @!@!AH@b!Hp 09@HBxB `<rB pD`8r8!  C8 X8!BHA $PpBB@@hX DB@@!(U@ HPL!0 pH@H  !@0 Pp`!A!B 09pC @@980y $ 89@B)q @ *q< x8@*8 p@ #U H !b @BP09B(!0CU P!B `!AH  !H  x8 @0 "xH #8& @(pH  BXXD!@B` FPD!!BA !HH E$80  x00 8 xD0#PD!!BA !@rH ̐ E$80  x00 <"p@0#hPD!!BA p$<0# pp@0#XD!XD!U H ! pB(@!`B@Pp@!` rH!U x @! B@8B9@pCpB!PB0hXp`B!B@0C 8B9JU  B @ !p s@0B p!8 890B pr$`80 0L9C89C p`!80 090CU x P BhH!U (@!XH!`Hpr$PB08X890J@HH p!80  8 #hH @H   H Bp@!b !@!@C !8 ` 8(@H0CU  HPF!U b` @!X09B0C!U HU H % @B@ (@!XH!PB@$ p`r$p 0CU  p9B8( PH!H89fP@!`bXXp!B`@9`C x!8 `P8(@B pr$8 p 8@8`Cp!@B pF!8 `@9(p$9Ɂb*H `B !`D!@C p@pP0!@@p0D!B p@pP0B pD 8<8C  HD9J PE$0 ؘPP!@!Op0D!KpB 89`CpF!`B!h P`C px8@09@C8F9`CXBP ! CpF! AB p8X@8$pr$`B " <  p. p< # p$D # p. pH # p@pP8$9PC@H!Op0P$P BBH p@!8 8(`tJ p@!8 8(0upJ p @!8 8(p@JPH!PP! HPJ!B BHXP!H@@ p A$80 PP!B`(X BBH`@(JP@!XPHX!E$B `B0 P !B@BH % PB` 0@!X!B8@9BC8PJ!  B%, p A$p80 pB 0!`8`C x@!0# p 8\@8 U0 PJ!H % H p A$PB` pBP!BX0!B@ $HP0!BXpB!B B!0AB  !B @B!80+@80#0 "H0#&P #0-pB @@!XN!@ B  @!0HpF 89C@@!XN!:H@ p A$80 P@!B X@!B P$Pp!B p@!0UP OPN!@ B@B @!H F< # P DBXN!:H@ p A$80 P@!B X@!B P$Pp!B p@!0UP  H  ! b p9B0X!BPB!@B @ H!B0 p <0# p.  8 ! 3~F 8a $BB@ !ra (B! `@8Cp A$PBC 0 8(pBXH!pH@ x A$`<0 P(!BXH!U `@!Px@!P B  pp8 s( $HQDPH($XPH! #0a0-p (!Pb C F!p PCpH 09B AF!0 0P9Cx B  P'80 hN!0UP F!I pDx8@09C pD pPC@F!0UP @@!BX!BHp A$HHPpH0#HpD@B@F!Bp08DX@HB@0P9PC !F! ` 8C@H 0P9@CH xs$<B p`8spD8\@8D `8 ̑p$ 8H@@!ȓPN!pHp F!B @hPN!B@54 x A$<0 PN! Hp A$JHHPN!0#Hp A$HHPN!H@@!BX !!B`@HB! B@BX HBpH0) H 8!0 89C pr$80 09PC D `` @@!@B H!C p9@09`C p`H!@80 8H9Cp H! B p9@09JHDHXp`H!` r 8!0`C  8H9Jp`r$0B p9B0UP H@@!B-PN!HH!BGPN!@ BB @!H D< # P HB0H0-O @!pB!@!Pb pBx8@8B8XN!  B@4p A$AH H0 @!`8CH H @H0#0P9Cs$H0UP  p !8  0 p.p # pBpPp$ 8ؿP N!0 @4 A$0#@PJH P N!B`s$HP  H@B p`8spB8\@8B `88()H@!`B 8@!P09BC8@!B $HP09B @B@!Bxy?Xcy@`s`BP 0F9BPx! p8\@88@!BX 0F9BPx! p8\@88@!8XH) 3~FeH!`RH(B!p0B@xP0!BHXH!U `!()`B 8@!XA!B@!C8D 0N9@C !F!p0 0N9C0B9pBD0CxP DBxs$AB p!@  p`8sx x'p@ p8 @  p< p@ #pPx@sH8@M8!WP@F!BP (XL!Hp A$H@XPL!0#H8@!XL!H@ p A$80 8P8!BXL! H@ pr$80 (P!BXAD!B`@ DH89@B @!`b (jX!B X P!`8H!,  (BPH!B@Xx B B`@ ppP89C r$0 89CHF!0 xX!!B@! CHD 0R9C8H9Cpr$AB  @! 0#@ pD  HBp@ #x8 `r<"`CHF!cPP!H BH 8 8(tC x`s$<Bp 09`C@$8U` H$xP BBpHXP! B hH!H@  0 HBXP!0 XP!PHPJ!ZHXPP!B@ BaPP!H BH 8 8(tJ pF!8 8(`tpJ pF!8 8(0u@J p F!8 8(pJH@!8PP!HPJ!H(PP!H BX09@!B @x$C px8@09B p pPCHF!B`8PP!BpHH$B`5<P !B0HPBBX!B@@HHF!hPP!PHB H ȿP09BpBHB! HzXP! B @P!P !B PJ!HhPP!HHB!XH!B`%8PJ!XPH!B@X`H % BB`8@9PC pB`pPC` 8@C p @!`80 0L9PC p A$ 80  p@@!`80 0L9C 8D!0@H8PpBB8D!:HpPx@sH8PJ! U0  p @!`80 HXJ! H8D!HPJ!0H p @!`80 PHp A$H pBPJ!HH !@B(PF!U ! pBȑ !PB@0PH! Bp&p C(!MPp@@!B ̑ p@9Bp(!PC ppPp 8B8 XH!x A$@B@ P80 0B!PH!PB81$PH!BU 81`b@!0CpB!B`PPp`B!B@ !0C 8B9Jp@H!p A( J!`rC p"pPx@s< pp< #ȑ"`BP0B < 88 8PCH@!XP!" H @ x A$ <0 PD!8PH!B@Xp H!0 B @X$BHPPD!: H @HH!PP!BXP!BCPP!B@X-$HP@!Bp0@'8U` !J!@H8 HFpD # 0R@H@C AJ!0#HD 0R9PCHJHXH!B`@P@!PH!BPJ(XpB!B` H!80 P@@!B HJ(!0#HBPp H!B@ X$80 PP!B@X$PHp A$ H BhPP!HP@! HHPP!0#HH ! H `@B  ` !@@ C p@pP0!@@p0 !@B p@pP0B pH 8<8PC" H 9JU  !`@`B @ 0H90B ppP@C@U XPF!@0 (PF!HH H !@B(XPF!U 0B  @!XF!@B@ !@H(@Cp U p.  8 hXF!A!B̑ p!8  8@ ˀp<@< H % `HuD p A$PB` pB(P0@! B ( 8D!B"H0Y0 P!B @B!B@ @@< #0  9 #% "Hp A$@B(B! bC 8@ 8,H8@x0 0 ppD # d0#t4`0#P6\0#  #87P H! p$p H  p"p0 (!`x8aXA$J0 @"P0 8-PH!PH @` H0L8,PH!A B@A B@0 p`$`I` @$PBI$H,A `D0 H0!B@ & B*!B@>@x0 0 ppD # d0#t4`0#P6\0#  #`BH p$I` $b $   H` а$AI 89?~C P80 xX <@p@$@ B!`H! B H!@B`@0  "<0 &8  $ P <0d #84l0#\8t0#D<| #+PF!U 84P F! @$ H$?~F $I aI (<, <@p@$@ B!`H! B H!@B`@0  "<0 &8  $ P <0d #84l0#\8t0#D<| #*PF!U 0-H a$pB F!  p?#`8c 8F    C A$  x@ 80 @,xH HD!80  p!80 @!`8CHD!@,@E p8 80  p !80 @!`8CHD!@,@e p8 80 8)PpBBw01p 0CFB@ x@X p8 80  p!80 098B0J(PFB x@HX p8 80  p !80 098BJX(PBB xHHX p8 80 (PpBBw01p #JpFB@ x@pX p8 80 'PN!0UP l2xF@f`<#HH"lIa@f!0BP"b 3L$!b`S @"H0+ "!H+ "1H+ "H0+ \"H0+ d"H0+ l"H; ""H; "H; E"H; M"H; U"H; ]"H; e"H; m"H; u"H3|"=0#QX !` sC $0 09C A$0 09pC@0#HXx`!@2B!Ё1B x0  0< # @8t0( `80t0(  @8Pt) U0@8pt) |H*p0( P@:p0(p@:P@ x@8t0(`80u9P 8Pu9 8u9 80u9 8Pu9 8pu9 8u9 Ѐ8u9 8u98t1e  x@!<0 8Pp`!@2Bb !80  `8rx`Hxp< # @8t0( `80t0(  @8Pt) U0@8pt) |H*p0( P@:p0(p@:P@ x@8t0(`80u9P 8Pu9 8u9 80u9 8Pu9 8pu9 8u9 Ѐ8u9 8u98t1e p$H("P ! pHp$H!P ! H0-Pbx@!09`Cp<BpP@9P8sp C@$9%J89@C@!0UP XN!B $8 #BPXN!H@ p$080 HF!P@!B 8hDX N!I$@I <0# H0#PN!PpBB@09pC@D 0P9C@H 0P9`CXN!BH @!$0 ((PN!HHF!HxPN!HHF!HXPN!`H 0B PF!Up@ 0!(PF!XPp@BrJU @9B@pbPR! B XA$8  XV`X8sxBsp$B !8 090Ch&PR!B9P)@!0 1XMXR!ЂH`@ p$`80 `L!P X!`JB(AX !BPR!X!B B0D9  C0D1B0D9 !F C0D1B0D9C 0$D9@X19<C 0(D9@X1r<XH!BPCh$HP R!HXV$PR!F!X@!8PR! Bp 89CXB!*H0PR!B0h$PXJBX@CJ@@!W8`L!:H(PR!HXH! B\XR!@H0D9C0D1pB0D9  `H 0Da18  at H0xE9 !F PK0E9 !F H89`CXF!BhA PR!0 BH89`CXF!B(B PH X$0 H"PR!H X$0 "PR!H(% B 0!pfP L! BP $B@ pB 89 C?8PpBBs89C 8@@Cp8B8hXL!`s`@x $BHp0 p?p< #pB 090C PL!XPpBBpC@9 "dB+rP8B18P0D9B@x $BP p;~F8`I?8 @$0 PL!PH @$0 xPL!H 8%BP P! Bp $B` pH 0 !$ BI0@9#pD8B8DPP!P 0B9 @pD( #x$p?p #989 BJ@@!8U`  8%BP P! Bp $B` pH 0!!$p r   HtpD8B8DhPP!8P0B9B@@, @ p?p #pH @X!@8@9#pD8B8DPP!P0B9B@@, @ p?p #pH @9 BAAH!( #`J@@!8U`   @B@P H! B0 $B pB 0!PH!XPpBB909J@@!U   @B@P H! B0 $B pB 0x!PH!XPpBB=0x9J@@!U   @B@P H! B0 $B pB 0!HPH!XPpBB109J@@!U   PB`PJ! B@ D~F85`C@B! U0 8 B8C D~F85KHPJ!XPJ!sJ0 B8BH  PB`XP J! B@ $B0  xD?~F85 09 C0!DhPJ!PX B 0B0H@9@CX 0p 0C@ 0CP B 0@ B pD;~Fs$85 0ǹ%`J@B! U0  dBH  PB`P J! B@ $B0  Dฃ~F8!( PJ!P 8$@9 ( ,@X 9<#ypA?# 85J@B! U0   PB`P J! B@ $B0  D`Xs0@ǹ!8 PJ!P8@9B !  C   D`Xs0@9J@B! U0  0)pBPN!  B` pF`P9s09C p$@80 FH PN!P8@9B @8@9 B89C 8@a18 at0C8@9pC8@9C pF`P9s09@J090J@D!0UP @D!BH3 PN!  BH@H!hPN! H@D!B3 PH09K@D!0UP   @B@PeXPH! Bp 849@C@@!UP 8 PH!P89 B @$J8 0pCC?#H08@CU 8`tH0H 0$`0 PH!H @I !8 H9p9 s@@CPD!U PD!X@-"BPD!HX 09B@$ @!0- B $pB F~F05؃~C8@9C8@9C8@9C05IC8@9 80CPN!@D!0UP  p$9 #xP N! @$`(8s0C@PPN! 88@Ip80 ;~FPN! Bp 89Cp$B@5 @!80 HPp$B8FH @!$0 PHp$ B@GXN!`H a$0  p pP898Brp !J ppP8<88BJ p !8 (pPBH8Xx) 8 p8 8 p08 (J 8@ B@@!PN! Bp 89`Cp$B@HPpH0H 8p #Bp #Fp@& B !D 8(pp& !C!p$!H,L!8,L p8& <  <@ 8(pJ$!xH X $!HBX D& L@xX x<& pD#8 <# PBfH !@f (JhXF! r ؑx!0Cp3$U 0B' s$<0 p !vIx ! (@!0B p`8s@"pJX09@9PH@fH !b XXF!` r@ ! p3$CXF!@ BT (4$P0 HP !B XF!U  -PF!` J )$`ZHА(JPp!H F!x8+Q<XH @x8+ @x8+q<H @x8+0H   H!U p 0! p$p< #PD!U pt$  H !U p@ !`8r!PF!0# pt$ H$`sxH0 $x@ #8"p$I Бt$`s<  "pH #@"@  H!U p 0!XD!UA БHA0|F@8A!0BXXhE$BaXT! `N!eXT!BapN!XXT!P T!@HpH 89Cxp$0BH p!8 09@BH 8D9,C `Fp$@ p?#80 09PB`@,`I p?#80 090CE?# 8D9J$H p"!8 09<BPBp 090BpH 88D8CpH 88D8 C (t$0 09 !0C0@9B 0FBp;XD8hVPT!hXT!B%p!X T!@H@HU @`xH0BH@,x`K `Fp$@p 89PB H,`Ip 89KD! 00JHpt$BK x@ p. `<s8 BJ` 0X9`Jh!P0H4$H h"(PJB`@ x&!L0 8L80C !80 8<8J`J@BB& 0X90BpX 09C@J H 0 `@890C !80 89Jpt$!H@H`ŒBpD  @&0# 0900 p$xH #@ " # 8Lp0&!LB &8 ! x8@8 0D J8 9@B B 0"8HXXT!,  pHAH@F!p8 s FE0#p H0# &x8$@`J pLpP@J`D!hnPT! H4$@H`Б `$p # !D0 HPpHB F 018, K p?#,@p8  HHp$ 88D0J`!8P!BH!t$hH p D!p #hY x$D0 H`FPpHB F 00p K8,wpU<,xp8  H0HxPT!0H8-B@ Бp$0BID !t$`bxD 09@Bp 89 B pF`<cY J8B8FC pBx8$@p P!`8`BpD BrCpB,pHp 098BJ x`!@ 89JpB@`8(JPP!`H8U` pFO 8Uw8F 890JpJ 08H8K8^@ @90|F  Бp$BH e@B 09 Bp 89Bx@ 8<0C(A!( :)`a !08Bp8,xp@cp80C8XR!0BXR!BXR!BahJ!HX R! !t$`Hp,C xDp<$@p 098B0!@@xD,xHp 098B0BpB89CpB BrJ8H9C`J!H8X@BB@U 8`,PpLB``! 088@K H!PR!p q J0Hx4$z H XB`<0 `X,0X 8PpBB`@ !`8c@p!t$pC !t$0 ,X @!pD$@I @$080  0 @B8J@B@@B0@0`C8,wpU@,p8F  H `L!XD HPR!B`%DBXR!BHQPx!B@B <@H()H @0! BH0,p 09IB pp8 sp!B0B9Bp 89pB pD9$@ x<Bp 89CpD@H1rH x80 Б0<@80Cp 08@8Cp4$ H 0 @ p pB0(PL!p0 PpB!B8 0N9pC8B!B PL!(U@ !t$0,H XL!HFPL!Hp@!pBhH Hp0 ,XL!`Hp@t$@HYp 89 p9$@ p8Bpp@8\@8() HА@!`BB B80 8!`8pC8B!B uD!PL!p Cp`B!B e B80 09p8BJPL!pBH]$PD!BJ(U@ ! PHt p4$@B@0XPH! B@@ @!0H A p$p@ #$@L0  "pP r @P@L0#PB `Bp( 8P80C x!80 8P8J U H=0|F (At$b@ pJp8 s@!0CHU `!8A!0BX`E$B`a!HXT!BxXT!BahN!XT!`B pJ@BHhD!`8C,` xHp<$@p X!`8CpJ 00CxH, `B!0 Bp8 Bp 098BJ p @2,h0!B@`J`N!HxX@L!B@`PzHD Бp`t$0B x@ 09@<BpBp 088PCXF!PH @XF!U (%B` Б !t$`BY= @b pF 01C pD9@p 098B8!P@pD,  = 9@p 098B0B 8A!< 89PCpF 00J(U@ 8NhXpDB% p 80  p@!p8 (XL!pH(%B` Б!t$`B pF`8cYB!CxDr$@z8 0N9B(!@p H p8Bqp 89CpF 00CxD,  9 =@8 0N9BJppBp08 (PJ8NXxDB% p 80 xP!p8Bp 890J8NhXpFBr J(U@  b@8XD!U xH %H t$"r r'0b@- HByp #p  @!`8rC p !8 88PC @@0 888C p !8 88Jp@!` BPBp 89C p8@09CC @@0 888pJ8@!BP0;B* D@@X@<0 p880 p 80 7@p@t$ AHp 01@8A$PB9 , HB9p$@p<& <Bp 09@8B@B x@<Bp 88pC p$<0  pD 80  p !80 888C p !8 88Jp@!a<BPBp 89 p 8@09 p$<0  pD 80  p !80 888PJ@! 0 (0pJ@' )0|F(!`faB90b@apC8@!X!B$H!0C@@!7@`X@E$BaXJ!pBXHD!B@A!X8@!BX!BPJ8 $BaX@@!Bo  U0 `!! 0|FA!P0B@XH!P0BXH!PBX8B!Ba(!XH!PBXH!p,G0! (A4$hH`C(JXH!`B$8!XH!U `!(`BXH!`B$8!8XH!U `!()@HYx4$0I 0!80  x9$@ p@8B pp8 s0D9B xq$<B p`8s0BG90B A89C p4$80 8F@F(U@  8hHpJ XpNB 8,ar@ # U` `!$Bt8Xp!H @x!H8HP e&2~F H$0B@P! \@  0!P8,*H!NXpHB(x$A&H  L8(p!&Ch@0 @`D0C 8p%9pHs@$0C0L!,r ppP!p8 C0P9J@!(FX85BJA!@1B0Y !P; @ plp0#CXp!BppHB 0 0Y p 8 8(@p89@J8R9@@," ppP89C8%9 CxH pK `C ppP89Cp!P B 8$9pC8$99 #B(!, p 0# ppP 89p89s,C p 8 8(p H! 0H!H pJp0#AXp!BppLA BDB8J,B ppP89 89@K0!CX85,  A Bvr `BJ0H p!8 8(wHRaK8%9JHS?# 8R9J @08p$pH0Bp 890Ap (0CBU `!B0B0XVPd!0 #d@!@BxX0!BH p!8 8(rJpL!0BP Z!`Bx8TBxXpTBpHhAX85BJA!P1Bv"H 0B plp0#>Xp!BpPJpJx@!` B8`HpL!0BP X!p #XXH$@BfXd!0H @x!H8P 893~F@ !0BP@!`b GX050C !B x < 8(uCF!?X85BcC8B0 @CB 0FH8,wpU,Y B!9@z D!8 8H, J@@!,r8U 0bhA!P1B`Y P!" @`Z pZp0#;Xp!BppJ0c  8H p!8 8(v0p9 B090JF! HH=2~F !0B@X@!bEXT!H (!`I8LC0N9 ,` pFpPPB8!` a C@$ #@c8p9 Hq C89 89pC890B H!01B Y H!9@ F8 8(p 89 YC p 8 8(pD!@B8H0JH pFp0#h9Xp!BppH! BC$B8F,B ppP89 890K !(;X85, P X! BUr` BJ0H:X85£U!C H!8H0`J@! #@c H!B(hH!X !BPH:X85B`JhD 1BpA!B` p\p0#7Xp!Ba05  J pD@ B8H0p<0#HhQ 2~F @!@Bap!B`bf@X8!B@X(!B9pC ,0P9`B@! 0B0`C@!`c0, p`pP8p980CB pDpP888@C 0F 8( r89@C89B @H!0#p@H!80@ K8H0J@R!`cH7X85# YCvb C H!HH!B 8XX\!@HD! B:X89BJHR% @"@ H6X85BJF B`c! A!0 8F4Xp!BppF0ƒ    8HhU2~F 8!0BY p!0@Bh=X\!H ($@&H L8J  P@0 8( p !&@CH0N9PB8!CJBhU `!8pa9 8$`C0L9C 8aaB4X85Y!CB!,r ppP898B H8JH8a9 0$K8`9 8`9B8`9pBB!1BY B!9@ P8 8(p 89YC p 8 8(pF! F!H pPp0#0Xp!BppB1 Bc4B8P,B ppP89 89@K!2X85, p x1 B Fr BJ0H8`9C0`9B0BP09K2X85BJ!,A!# @ ` 0 8F/Xp!BppF0#  8HB!B B!X!BH@B!, !9@@ ppP89 89 ,J !9@ B8 8(pJK ppP89pCHXBBY p 8 8(pJ Hx@!B HT!0BXHe,Pf! b0C p@pP89`B 0H #(J@!08D9B D I @<BH`rC6Xh!{H@ p$80 `!PpDB@ !pP89CxP H,8 ,"B xxP 09`H8s<"@C8(pJH,r`!pBH,B P! 8(p!CP09BC pLpP09P8spPC8N!`B8Y0P B pLpP!`8JpD  r` P' Ȩ !$8 8(pp$pJ 8\980 x!@!pBHXpP p@ q ! 0^G90B ppP09C,D!pBXV!X@P0!B@X!pB HX`!B0`!HP0F0a? hbsPV!w1xrphY B 88F_%1xrphYC pP 8 8(p8D!B@ P09BC pLpP09P8sp`C8N!R! , @D! 8(p09pJ pD 8 8(pJ28,p p`Bp?#`aPB ppP8$9 89CPV! 0HX #(J`r0CpX 09 C@X!0!`BX P09C8J@@ P89BCK\!,B ppP!`8JHbB8X!B`XXX XB@HX!h6Ph!Hp $ B 0`BX!B`hX`!B0HH=f A P!`r0B!bC`B!C pBpP09BB ppP09B`B ppP09 ( $0B.X(!B!0`Cp F!`C$* p80 .XFB@$B8F9Jp$ B`p $ J1,(YhP0!B@0F8`CJ9B p F! 80 `D-XT! ,  hD@"!@@X0XFBC0F8K`H!BJ]rB Q 8H `JpN!@"@/Xp F!B 0 -XT! ,  hD@"!@@/XFB@JHB_@(!H&H B  H 3~F@!@B x!0Bp xx8+XXF!U `@! 3~F x$@B@ p!80  0@8B# @" 90C "P09 B$p@!X@x@ !C p"pP89`B(@!h?P(!Ba(XH!U `@!(@!x5P(!BaXH!U `@!hM 3~Fp!f@B 9bC p@pP8H!0C pBpP89C1xrp0B pBpP890Bp% B ! @(p@9`8p@@p" 89C @! @(px!9spC@$9@ x8& PC pBpP09p<q0C p$pP0%H@(pCp@!$H H $@Bx(9`@B   8"<0 P !8(pp D, `C9@!0B@X890Cx  BxP89CN!<(aXP! 0!B ppX p 8 8(p09B0(9pCX!B @ $ p F!0  x<\@<P\!B(5P FB  F!HX !BD!B@4Pp@!B DBX p 8 8(p@B09 0$9@B0(90CL!<,` p 8 8(pp0#p8 DBX p 8 @(p@9`8@@p  89Cp@!HB H DBX p 8 @(px!9spC@$9@ x8( PC pBpP09p<q0C p&pP0%`HD,r P098BB0*9B pBpP09 8B`B pRpP09@ B p8T 8 89CD,r ppP89J0H9CpH 09BH!)P\!@ pB!8 8(p`J pB!8 8(p0J p B!8 8(pРA HH$H p!8 8(pJN!BHX!B @ $pHD!0 H9P\!BX!B  Xp !B@ @B x@<B p8\@8PHXJ@H@H!`a@!`a0H8`HD,r ppP0$9 090J 0(0p< #H()3~F0@9@b C8@`B%0N90BB pNpP8p!0C pBpP89C1xrpx0B pBpP89B p%8B FP@ xp8" =s@x,C@$9pC pp8 rF!PC FP@ @9P<sxJ@(pC@A!BP8X0D9B`x@0B8 D,1r8DD,1r ppP09@B09 0$9B0(9CD,1r ppP 00p< # H! DBX p 8 8 pP09xH@C@9P8s@$9C pp8 rp@@B@`C"!D,1r pp@8(@9P8spJD,1r P!`8sBp% 0&9Bx!H xp 09PB0$ 9 0 90B 0( 0p< #D,1r8@(U@ `@! pB!8 8(pJ pB!8 8(pJ p B!8 8(pxHH$`H 0D90#D@!(U@ `@!  0b@@!PBCp@`BpP09B ppP09BPB ppP090BX@ BGp%s! BBB@X!CC p"pP09P8spC@?# 84 BpC ppP8 z @$ <sx$0$9`Jp  8PJ!@@!D#@@A?#H8A3~F@!f@`bxX!B@8X P!5<P! ,H BhPP!B` XP!D B`@ pTpP890CP$Be<P!B x`s$<B p`8sрJ9BJ9BxXP! B pD!H` L p0 P(XP!PF!HPP!` rpCXF!B P$0 XXP!`r@CPD!B<xPP!PF!B<HPP!BOp0aPF!BH'P89C!@9B(|X r@aO @0D9B`  `9d8 =z@  0<0ChPP!PF!B<8Pp@!B @x$J px8@ 8Op0aT"sP`C pTpP89C0B p@pP09CP@!XP!B<XH!XPP!B`X!B8D9PJHXP! B pD!H`L p0 PHP@!HxP09B0BP$BX09CP@!XP!B<XH!HPP!B`XP! B` P!H` P!B@XH!HPP!HP@! HXHPF!B0B'PP! BHPF!B XH0D9B0CXH!HPP!PF!B<HX$P09B@Jp $&H`aP@!B ($80  pp #hX!BpH HxH BHH ! Bx$"J (!0b !@Bp 89CpH %@ p$@80 PH!wPH! BAFB@8RHXPF!B XD!Bp!BXQP!B PH!>HxPN!@F!G`(aH@!P09BPBH@!B`aPpp!B`@ p`8s8F9pJHF!xX!BPH p@!80 8X9B @H! !0CX!B rdhE|@F! 0RKG`(aH@!ءXp !B@CH@!BHB @APpB` (cH0C0F9JHP!8P!BH !B 0UP `@!()0B8@!B @bX!B8@9pC p@:~F8 pC p$80  ppP89PB p@p<"@ p`qP B$8F9B@BXL!0 B H1$$H@uPL!B(U@ X89B%HXI3~FpBB@8(wpBCpB!HXPX!` r@B xB!(Hp\x3X09pCpB!ȣXX!>H@ p$80 xR!rPp!BX!B@ F,  0P90B pBpP09`C @!@ # pBpP09 0!C@!`rЀL9C p p8 sрL9@BL9@CpL 89 Bx$H 8oPX!`HpB! H5XX! BHHHp $BmPp!H ` !x8+Hp$B68mP8!B`H01fB9PbC pBpP09B89 HBpCHB!HxyPN!` r@B PB!(HH-X09CHB!XN!j@H @ p$@80 PH!(lPH!B@X!BHD!BHX!BHD!0CPH!@HmPN!HF!pXN!p r@@ X!(H@H@&HX2XN!`r@CHD!B`5lPN!HF!XN!H@!B`lPN!0U0C( HB!B`XlPN!G`(HB! H1XN!  BH @HH$BHR1X N!$H H   B p$B0b B80 )Pp8 `<sB x@#?#x@pH<k`qP0B p@pP89pB0B!0BX89B@B0B!P89B@C$@D! U0 hX89B%H(-3~F @!pf@b pBpP89C89 89B0B ppP89C p$ x)x p`qPp@!C ppP89@(Bx|?#rHyBpx)p pp<@`p`XL! ,@B!?P a@B!P09B`B@B!hX!B?P aHA!BXx@!B@PB@8X!B@D C ppP09 BB ppP09 B#`B ppP09  $0B@!X!B!rdHe J@JgP@B!B (U@ `@!@B!XXp!B@0C p@pPC@@!8XL!BH@ x$0<0 HF!xdP@!B 0Xp$B @ H$ B8X9B@@! !0CiX!B@B!B@UePL!CD9BC pDpP09BB ppP09B#`B ppP09  $0BX!BJ@D!B@Hp !B@P09BCp BpP09 BB ppP09 B#@J ppP09  $JXPH@@!XL!@H x0$<B@,PL!  BD9pC pDpP09BPB ppP09B#`B ppP09  $0B@D!xX!B!rdH0JpHsXHx@$ p!HXX@!BH xt$<B pp; w!K8,H!@H!H!H!HH=3~F0!0BaP!BbXp@B@8(p!C ! "@ pDpP89 (J!B F!Y p@ 8 8(pC @ 8(r(J!K 89`s(K?#J0J9`C 89`s0M?#PJ88C89 0L! JX85BJpA!: @b`D!B p\p0#xXp!Bpp@1 Bc4Bx@!Y8 @ ppP89J@@ HU `!H93~FP!b`XXpB@XB! HpP89H80 X!B`@`A!7XT!B F$H 8BH^Px@!Bp 89B0D9C0D1C0D9pC0 D90C@'HU `@!X@!XX!B8A;I @Fp@ `@ @  Fp@ `K0 0K0L9` BCXL!،XX!DH P`N!([PX!B0XT!P B X!HhX!DH PXJ!B\PxM?#H PXB!0B84X HB``N!DH8\Px@!Bp 89BxH 8<0C pFx8@80 8H BH@$HU `@! p@@!80 !HX!$BXV"XT!@!HU `@!0D9@H{X@!B@X`H813~F p@B8(r89B0B ppP 8Q£H@!0#XP09B@BH@!0B`Pp!B@ !A p@pPp@!B x< 8(r89<BPC ppP 8t@ £$p 8F@CH@! H`( $P FBD@J!8U` `@!H@!Xp!B@0C p@pP@C 8B9ps@B!`C FpHp !B4 D80 PP!HHB!ȓXH@'8U` `@!093~F @ a!pB@H@!f`a 8B9<B`a!pCX!BGPD!@CX!1BbHHX01C0B9@C0B1 C0B9C0 B9!PC@@!G`(b p!0 P@1BXP!B0BHH 0R9Cp F, "r 09B8!0CxXN! B!rdhe0RJUPN!HHD!"rXHx$FHPUPN!0H89 @`$pJ@!G`(b0B9Hp!BP@1BXxX9X@ 8 !$h 89B0BH!0CX!BazipR pJHp@!Bx1BxP@1BH80 uP9X@ 8 !p8 sH0!0C8X!BJx$B`PHD!H`U 3~Fh!X@e`0C pBpP89BpQ?#BpB0D9C pDpP09BB ppP09B`B ppP09 0 $0BHX0!B@!(XZ!3!@@ !$H&,XPP8L9B@PC8P9C@! BuXZ!BY` uXZ!@N!wxU `@!x$H@ $<0 T!xOPB@0D9CpDBpP09BB ppP09B`B ppP09 0 $0BXX0!BP9@6) L98Z@ Q9dpD8@!B@@A!@0BXx@!B@C p0r @ pL (9@08H0p @pB p!pdR p?# I!@N!,@P#$NP8!B0F C A!@0( p@pp< ppp0#@J0@ B@(Y@!,0Q 09(Yp  @J pPpP09 pD!@B p@!8 8(pp D!B(~X@ BH @(c40 D! ЀQ B@BD B`HD! BqXZ!B0Y H@!,@Y (F ;@lXZ! PJD!,@0Y (L ;@xlXZ!HpRh8(pB|X@ B`C, I!p( hJpP0hpP09pJJN!B@P$$KP8!BpH0!H88B4 H0!H XEB@XjX8!B@ @!$H8@!CxD!B H0 hHX0!B@8X !BhJXX!B0JB@(!N!B F!0 hX0!B@X !BhJXX!`r0J@CpR!xy$$JPX!8N 8N90J`P(@pCh!MX0!B@XX!BXU hP!8XX!HHA3~Fx$f@xa!bhB!Cp!0BX8;CpD BpP 8! `D!yXT!2HH@ p$p80 hN!HGP`!BlXp F, P B P h$`8s( pa\@X!B@DPC@ @90C p@pP 8Dp@$XD(p(nX! T!pP (`Bx@$C p@<0 pP89 @!C! "rD9B PC pDpP89 0L. C89C0B9C0B1`C0B9pC0 B9C8C`J!BFPT!B_@a`D!BFPT!J`@!BhFPT!PHa!B`FX !B0B`F 0X9C0H9BK~X!B hN!JH B!EPT!Hp@$BphkXT!Hp B`ph09B@`! !PCXHX!BȆXT!@F!H0 L. hD!`PJp`!B0`HX !B@PKpP (@J`!|X!B hN!bJHHhN!HHDPT! H0B9H@!Hx@!B0 p@8B`fP !B@KpP (pJ`!{X!B hN!JHHm*3~F' P!BpB0B P A!<B!P<Bp @!p0 8b8lXXp@!B@ V8 !px@ Cp?# 88 8 CPf!0R9PB0C`!pNH=Pf!N!`B=Pf!@`$ aN!X89B(N B(NH`$(0rPJ pN!8 8(p J pVpX p ;~F ppP890CH!H pN!8 8(p8Z9pJ0L9`J$`BjGP09BPB pVpX p 8 8(wPK(NH pN!8 8(p8Z9J0L9 0L9 B0L9`J pPpX p 8 8(w Jp$PB6%$0B pB9Pp! B  8!09#  8,px p # (< 8(p`HVHX x 9@ S p8 8 `8( Bh$@(p 0DB8VH<,r ppP09 09 B09Jx$0B81%$BDB< `BH9Pf!Ba @!p(HnX@!B@hX !`B 9%$7PpJB@8,r ((!# pVpX x < 8(rp £&@PQ B@pp<#\Xf!PBa%$8Pp@!BxHjXpN!B  0 @ p@ p@qPp@!?#pB0|98 `C8$5@(PB09 090B09 C09J@$pHN!`BXH!B8؉P09B0JN!`HAPp!B@$@!K ppP89 CpP!J ppP89J pP!8 8(u0D9J 0HH8H`H pN!8 8(pp D, PJ090B 0FH8F 0HH8HH@,r ppP89J<,r ppP09 09J09K09JpH pPpX p 8 8(wp$Hp?#P B ppP89 890JxfX p  p< 8 p8 ( C0|9JJ!cXf!pLH@ p$80 `!2P!`B WX@!B@XcX@ B@ @?# #X0!B@!pB PpVB@!`BpX p ;~F ppP890 C6Xp D, B @090B 0FH8F 0HH8HL!`Bh2Pf!PB%&$H2Pf!PB)&$(2PpVBH8BH@!`0B!XxVB@@<,r ppP 8<B8VJpHD!PBHT!XXf! B8 !'$$H (`B(1Pf!`r@CT!`B0Pf! 0RQ()'$0C0Pf!@P! aD!PBHT!Xf! B8 A'$$H ( `B0Pf!`r@CT!`B/Pf!0R9PB0KJ!pNHH0L9@C0L1B0L9J8J9 8P9B8L9C 0T$ȣPq'$ @C`!.Pf!N!`B6.P@R!BO U `@!@(wx$`J@H$`r@CR!pNH 8.Pf!8L9X@ 0X9C8L9C0L9pC09 B 0F #0H9pB F #@ N!`BXH!B$PB `HN!X89JN!Xf!P B8 &$$H-PpVBPJ! 8BPKPf!@H p!8 8(uJp D,  090B 0FH8F 0HH8HH0M9J@s$p s0B p !8 09Cp$ H0L9@H0T9K pTpP09 0RG90B pRpP89Cx$PB&0H$`BjXf!PBv p$P80 J!*Pf!PB('$ Hp D,  09 B 0F #0H9PBH`rÁHр$H@C `BH*Pf!0T9pB8 TBF!B0KhXH!BP`!pNHH!X-XH!B@HL!BHN!pBxXf!PBf H!$H  `BX)Pf!PB'$@HN!XXf!`rP '$Hр$H@C `B(Pf!0R9PB0C`!p;NH(Pf!N!`Bx(P f!` I!H p!8 8 `<s@dX%HN!`BHX f!H p !8 09HXM3~FbxBBH !<B@ < p@ #pX p 8 x|?#p8B0h5x)@B px8@ pp<@`p`p "1B 8P  ,rp 09p8BCYXx8) ` p8 8 p08 ( B0|O9`C pR8B 8R  ,rp 8!`8pJ xPpx a !Cx$`r CpHB(8(pCxJ!%PX!xJ!H#Pp!`rAX! B <8#FpRB8BoPbp@!B@ x!BXX! B 088I` C088P C09`K ppP89@J p!8 8(pJ 0LH8L  8$@)BxJ$PX!Hp p"1B H!Bp8NXX! B pNH@ 8R<0 IXX!@ BH(x$Bb p!80#X8!B@xJ!RH(#PX!B(})$#Pp!B pp8 sp! HPC pp8 sp!PB p`8sp0IxH80J@`$oPbX@Xp D, `r `8!0C 0H8J0H9B8pp #%X@!BpN!cXX! xRxX p 8 8(pp! 8RH x0$<Bp,HPX! BpH p@s$8BDx!8)x x 8zF r1xrp8ƹ!JpH!XXH1X`Hp 0"1B b p@!Bp8FXpFB@9 8R0C ppP89`CxD!BHX !C@H! Hx@$ p!`H=Xp D, B@ p!p8 s8F9 @!J090B"X@!B@]XX!Bv @!$HxPX!H>Xp!BH xt$<B pp; w8,`Jx@s$`rF<Bp 09Jp@! Hp <89#!a(X X!` I! xp$<BxH8 `<@J@d$PHp@!BYP !BPHpH!GXp!B@PCx@ ByP0Bp 0\9Cx@s$B 8! 09CXX!B6 x$<0 P X! p0$`@sx!H8HJ p!8 8%Hp$BxHx!` <(@BGP@!B@p!0CTX@!Bp$BFxHpN!Hp@! Hp <89#!aX X!` I!pHp$BxPX!`HxD! BXX! BA p`8s 8HFH8HHp$ (H@P!@H !B(JXX!SRH@ x$P<0 xJ!hPp!B `=X8!B@IX@?#B8 xJ!@ #@X =)$89@ ppP090CPX!Hp$B 80 H?X !B8xJ!RH8PX!HB1~F  :+$Bp$01BEeA!f ȁ!C3BH`Gf fp #q!2r@H9` Ha!ePbB@0 #uPr #}Pv 8V90CGXp B, B@*F@8*spXd 0d0Y x < (!`89sC010B09pC01C09 C09` C% PB8D9pC x(!p<@p 89@B xdxX p 8 8(ppp #(($B>X85Baa8BP C b p ! 080< @B p!p`R p?#p! x!HX! 8,` ,$p #P`!Bxb@0BxX x!P !aA@ xX" L,@’8 x # pLpD#Lb2B $` ,rp (!`89Jpa!1 pC@L!2B@Y dpB@h (L @ #RBDXpJB@ 8(p 89@YC N!ZBPPpL B@ ppP 09 8N! Zp8 C@$p B@ -$pP89`B0!P0L9B H8p sJ8L9pC Cpd($@019"s!B09Jpd`BpXxbB 0`!0H(\@{<@ #!rH  x. `@8(XL!H0B 8@1@B@C(X09B @!0C@!U X 8;B @! @'8)PB  8@8B@@!`bPC 8@08 #H@! 00`C x!< 89C !$,`H H@H 0R9C,IHXH` r @`s1 `Bp 89C p@ 80  x!<  p . p< #@B!8U` PP!0 H(!8X P!J x!< 89J p@!8 88 (Q HpHHB!(PP!0 H! 3|F $@B@8A!`BX8 0B0!C8$Xp!`@` 0Cx~Hp?<Bp@3$p r$`80 HoP0!B8B!XH!U `@!8XH!BHPB !@BXp!B0800C!U hHU  % Hx@3$p r0bC @80 fHp8D!`8BC0@!pBoPJ!,  px8$@ U0 (oPJ!H B@8@9@BPC @XH!PB8XH!U I`80@I  @!Ap 80PCp,pH090Bp !p8 rPChXx!B@!U U H(Xp$$B8Hp $, p9$@@@0#! BB !P @8`0 HPx`@! r@H! !A`A pB@<0# 8 8 <BU pBB "8#)q< *q. 8\@=8 8HxB!O B! pp8 r wp =0#p8B  ! Op $, bp ( `8rpC (J”B*8J9PC pB0 p8  0 `8@C@0#U (JHXH!H J  p !<0  p@!8 8,xH xA=By !D0  p8rp !@B0C qp@@AxD0#H J  p !<0  p@!8 8,xH   H ) @B@(@!$XH!p r H@!H  8Q80 (J`80 X?XH!U 0)H @B!B !@  F@0(A`phN! #`(@B !PBPF!U   Bx ($Bp 09   H  Bx $Bp 09   H @"H@ @!80  HH B@p$BHp 09 @  H B@p$Hp 09 @  hH B@p$sp 09NH" lH   H ! PH 0'$@B@0LcPH! BA$U  x"x80+A0# "PH x$ B <0 0908B@C pp<0#dPD!U !Bx@ `r ! $0C $0 890C@U  !PBXp@BpJ@U () I p'$@b D080 8B9@@CxDB p<0 89x0B8B!B u8cPDBC @B!0  p<0 89x0#K p  8!<( ppP888`JX89B@J8B!B 5hbPL!(U@ 01 I x "$pB @90   pB!p C @80( x0#8 9ApBp@B!BPB x@80 xP H!8 8(xCHB!B`HaPDBC pB!@80( x0#8 9APJp@B!„B  C H@@0( `phN!PHX89B0JHB!B`Eh`PN!G`( XV0 @ ,xX`H0-rH BpB @qF!80 ,]PN! B A `!@I !,  @q!0  x80+@E0#$XN!0#`(! 3~Fh8A!@B b( #XH!U `@!B !PbB !`8 `,XF!U (-3~F@p@! 0!@bX  ( 08(pB @09C01 B09 CA?#؅X85pC@!x@ BxP89C09A01pJ0l9C0l1B09`Jx@ BxP89<(C89J@!(U@ `!09`A09HD!H0p9C0t9J0D9J@$(U@ `!PA!1B 5@@!pB pTp0#Xp!BppB0B8@J 0!@?# H p@pP89HH! @B@ (@!XH!pH@ 0A:$`0 XYPH!`(x@0B x@xP89C!<(  !A@pp$`C( ppP89Cp D,  x  8 8 $!X!9@ ppP89C x < 8(ppJp!D,0B ppP89pK$!@<@ H, L8 8(pJD,pU  p@!8 8(p% H013~Fa8!B PbxXN!BH@  tHHVPpBB@ !pP89Cx|?#,H{Bpx)p pp<@`p` pB!8 8(r B pp$p+X85BpB 8D`C pBpP89 J@H!#`(bXA!01B@ @!B pVp0#|Xp!BppF08 B 8H050KxB @BX$80 hPL!Bt p:$80 8PL!B p $80 PL!Bt pP$80 ؅PL!B p 3$80 PL!BTpz$H @'$@8B!H D0 !NH xP0# pxL0#8$PL!Bd p  $80 PL!B p :$80 P L!H ԑ!@`H 880 8 XL!(U p z$A0H  $`$ !H!H!`H!H8F<0  p D0 $xL0# 8(T0#D,PL!H   B XD!U x`K$ZH !H x@0 !H @(8B <& 8B "80 8$B !b p@p0!HPF!`H @P`H(J\P F!B x$I  @@Bp 8 % *H@ p`0$`H0b 0 09`8BC0@!X0!B@$YP0!BhXJ! p! Uxx$I0  8D<B x@0 < pD0#[PJ!`BȊX0!B@$YP0!B~XJ! p! Uxx$I0  8D<B x@0 < pD0# 0B PF!@BUXF!@jHܑ !P0 X @BXXF!TPF!8P@!B 0`H !bFXXD!p r` pC!PD!U xPu$ p`8rp8B8FȄXD!p r @H %  I (! I` 0@!  "8BR8@0?)C C(XJ!zH@ p`0$p80 hVP0!B{XpB0 ( UpX p!D$@pX 8BxD$@0    p@ `0  p,"9B8"p8BX%P DB(XJ!zH@ p`0$p80 hUP0!BzXpB0 ( UpX p!D$@pX 8BxD$@0   810xF@ @!BPThX89B@(0$CHA!H` wX89BCPB0@@$9`P8s`CD!p@!,  BQ@9`h8s@p,JB1rp0r0J HB!PJJHHXH%B!B@C pRpP09pC09 0$9PC HR! 8(r$09 C@$9J xR!< 8(pP9h8s`CP$9P8sPCqy!@C ppPP9h8spJXP!0B@XH!uX89BC JHH!}XP!8U` `! p@G?#p@0$@!@@P$9P8spCjD!YPC x@!x@ ppPP9h8spJ @!@ ppP89 A!K x@!x@ ppP049 0(9B09 0$9B 89p8sxD!PBHP$9P8spCjD!YPC @!@ ppPP9h8spJ8P09BH%PHF! B@@!00BX P TB`Hx`0$HH5PZ!H x $<B@ p!80  p pp< p0$H p@pP89C0J p@pP89Cpu$Jp 09J p@pP89Jp@$B?P !BHp@!`8s@C ppP89 p $ Cp6$x@!80 8?P !B @@Hx@!{H>P89BJp@$B>P !B @@HhM  I8B9BHq$BPB D`rp`0$ XCHq$PIR0#X09BBp@BpP89CHbX!B@f V!0P!B (VX \!@0#Q$0 aX \!BI D0 0`9 CTaX! H pV!/P!BTUX\! H PpI 8R0 N APp$B@ J 8NBP@pP$0  J@8  ,\Xp@` s pxBpP0! 89CJh`X\! 3H@ p`0$80 V!.P!BJ8TX!BL9 H0BJP09C0D9CJB@F(/P\!P @Pp$B@ J 8N CTX09PJ$0 \X\!` rP C !I T 8  ,ZX09Bp!8"s@pr`0$ ZJB!^X\! H@ `0$@0 V!,P!B XRX!B@HB!B@6(H.P\!PHJ]X!B]X\!@ @@(! `0$  0,@Y `!@,Y X B+P!B !XQXJ @ pD!@ #(QX\!H@!\X! H pV!8+P!B pPX\! B D@Ix\X \!bH H0 XXX \!0BI  x@$IF@80#  #0`9@ ChX \!@0# $0 0`9C3X DBpR 09 C01 C09C0 9`C($pIpJIppBp8NIC @!$J 0`9PC pbpX p 8 8(pC@!`$p`&@I B08BXp sB @!x+ p@p+ p@pP89@C @! 8(p89J@D!#`(@FP09BB 8BH@9PB@p@p s  @!pbpP090C p@u$ <(009Cs$<( r$C89  $pC89@B`B `$p s p`8sp !0Bp 89C<( r`C0F9C0F1B0F9 F9C0H8BPp`0$ 0`H@C 0BPR!2xtp`(8JF9 CXX!B0 h$  B`XYP!B(X!hX0 F9B`( `L!`sP,rp?8#8P@@!Bூ @Up  F9JXH!(PR!P BHXJ!xX !B0 R!PBPPR!BHXX!B0 h$  B`XYP!B(X!X0 F9B`( `L!`sP,rp?8#P@@!Bூ @Up XH!RHP09c$BxD HX@!BؚX !BHxs$"I p!8 09@BJp 89pJXH! HP09c4D@HXH! HP09c4xDHXH! pPHXH! pHPH 0-pBNPN!@ B $@$I !H0 088Cp BpP89`C ! 8D 0`A x ! A8(pJ pH0 8<8J p$`p@ap`@,px8&@Yx ! xpC p8 @8B 8B9ChfP N! I !0 X !BXXN!2*H@ x`0$<0 P@!B (XN!"H@ H1$0 kPN!BDxXN!P@!B`(8eP N!bH@PHXN!(P@$B`( p`$80 Y p8 @8B 8B9@JdPH   BmPD!U  ()@b @B!@Xp <B ppP099spC@$9 A!PC ,z !8 8(r$09J0D9 B09Cp r ppP 89p9sH8BDH-0C PR B F ,p B ppP89`B@ @!@X p 8 8(pPC0 9:J0$pH9 KJp 0B ppP08R8`C(U@ 8!1$B8N(PL!OH8A1$B8NPH013~F a$pBpH 89 CxGP!BH! H`aXp@! B 88 0C@@! BHx P!, 8 p 8 8(p89PC B!Y p 8 8(p89Jp 0B @@!B ppP09CXp@!p@ a 8@@!C P!8 hPP!B XHH(PN!B@ p$80 P@!B`(aXN!H@a1$B@PXPN!@'0UP `@!! `  ! b`(p2 8LƹaBXH! B@ p$`80 8PH! B 8$`H0PH!`r0Cp@PBp0C@@!U X@@!B0@!p  p@@0#!p8  p@@0#p@@!8BJ@!p @ B@ @!p rJ8@9B@B!p@ 890C x!80 89J(-0BpB"s@0!@bppBC p H!<( ppP8<80C F!Y!p&@p 89CpB J@B@xqP89Bp!090 ! Mp ! @,PC!p&@p 89`J@'?P XX89BJp$PH()B@pB &@@ 0!@BI$p8 CH, p 8B < 88`B@EB HBH, p 8B < 88PCp  89J@!(U@ 8DX8!B @FP8!B@DXL!(U@ (-B`pBpfD9@b M8C p H!<( ppP8<8 C F!Y@!p&@p 89CxB J@B@8nP89Bp!09 @F!0 PC,p p8B 80 89pJ@'?P (X89BJp$`H():H$ B `B Y8D!@b@Y B 80 8YP!B 0 8! @hX@F!BPD a(B(! f B!B X$`XP!BXp@B@9,pP89pC 8F980 c!0V9"s@Y(!BpBp,:8( xhxP8<80C L! pJ ` apB p@!plR p?#(AJ!@R!P,h$PH!BpN ,@ 0H!H=@ pp<#,r ppP89J@R!,rU B!`BX89BJxX ` @ pB0$BHRHOXHH!>$BHRH p$8 XP! B  HRH01H 8!Pb`B !0 0P9C xr$<Bp 09C8@9pC@@!B@XF!P09B@C@ 8@9J@!0UP XN!`HXN!0#HH!BxX@H!B`(A@!dH @80 0H@5)@B x< <0  p8 `@!@$ @B@ (@!X1XH!`B@ xq$<B@ p`8sp8\@8ZX!B@X!BHXH!`rPC (@!0 89PCXH!@!U 8X!BX@B!B0()B 0!p0 X!B@X!pB 0@D! ,XL!pB 88 @a>$ CXL!pB 5 @zH@ȂPHF9B 00@8 CAFaH(U@ @P HHX!B`H01@B 8!Pb p pPB BBXN!  , HB!BX8 D0BBHX p! 8 8H 0UP @BHظX !B@@@!CH!XN!  B@!C H>$0 خX89C!XXp @!B 80  B8X!B@@$B@ p @!80  BدX!B@@$@CHF!XN!@B!,@XF!XN!BX09C@ 8@90J@H!8XN!BX09J@!0UP @D!XN!X@B`(XXB 8D!HHXN!BXXN!BH()3~FE8>$ 0!@b a8N(1P!BCXp@BpBpPB0B9ChXL! B@Ap@!B  8X8 0PA!pBȮXp@!B8ȮXL!p@ A H$@zH@0B8|PL!pB@N!(U@ `@!@@!pBXH p@!p80 0N9@C 8F!BP ap=$H@(|PL!HXp@!B@@ p80 xXL!H@0B8{PL!pBX L!DpOHX!BȬXL!JH@0B8{PH8F!xXp@!B8xXL!BH@0B8zPL!8XBH O@ A?#@B0@5U CX PH!U  ) 3zF(!0ba8@!Xp!B@x%@B px8@8<8 0'Ap'pH@0@! 9B BB8B X!BC@B!0!@L! U0 `!8B!B!hX!B0$0C8!BؘXp!B@x%A%`B  @A!8 p<  8@8@1`B px8@0@8@C+X09J0B!XXJ!hX0'H (8B@bXpBq0aB0 U0 `!ȡXpBq@'JHH= HP!B(@!b @!8BحXT!B N!aH@!HU p ! CHpPs`( `N!<B 0!pL!`8s`CXT!p!@!HU X8;BHp'HXM0Bgp@@!Bh!f@ `@  @P@0 pI?#"sp29pC0HH9`C0@H5Bp2$ ) px8@ pp<@`p`xJ!X89 Ap` BpP89PB p!8 8(pp`80CxL!X09pC xL!p s0:H9@ I ChDX!B)$@0#h`X8!Bp=$B0 $80 xsPpPBp aN! (HCp0N!@B 0H@ 8 p< 8 ضXZ!`Jx!@!wP`xL!BXXB@xX@B@,pa$ @b0Ca$O8b08H9C08H5@B04H9pJbBf0H0HH9@JbBHbBH0B9J0L8K0D9pCxP!XZ!B@ؑX8 0C8X@!B  P$x PHD B 8@!2X FB`  @D`r@!J=X@!B  P$ PHD BB 8@!1X FB`  @D`r@!0J(=X@!B  P$x PHD B 8@!1X FB`  @D`r@!JXp@!p r F80 @!U @H !PB r 1xrp!0Bp 890CU FXF!H PB $@B@pB 89PC(!&Xp@B0pX&X H! $8B8B@0#(&Xp@B0p! @B@ (@!X)P!B@0C@B!U XH!p Bp$PH P0 XH!H! @B(@!`B@`C(PH! B@PC@@!U (B!8(PHXH!p Bp$PBH P0 (XH!H0B 0@9@B0C((PF!U (1`B @B!B%P!B@0C@F!(U@ XL! B HD! I  P@!@80#8NXL!H(1`BHF!`r8@!B`C@B!BH%PL! B@PC@@!(U@ 8B!$PHXL! B HF! I  PB!@80#8NXL!pH % PB8B!B`0@!0Cx$PJ! U0 ()0B 0!@bJP L! @H@DpBHBP8;`C@9@DpC$BP@9BGJ x$<B ԑ <B0@9 0F9Bp 89C@!(U@ 3P@$BP 8@9!Cp @!B p 80  pDpP89 89pC B!Y @ 8( s 1xrppJ0BC8D!X09B@C8!P@BJ8F9(Up! @! !X89PKp  B89`CpP8;`C@98B`PC$H>P@9BGJx$`@C p!80 8@9PB@0(X@BC !@!0 0HX09JpB B03P@BJ8D9 Up! @!h/P@$B@hX@!B@! @B  ! b(PH! B@ 0@PBBH(JXH!PB p $`80 8X H!H pP80 h(XH!U `EB@@!H8!`B` !PB`p!H p`8sp! @$Bp 89 C p$0 XZ!BHܑ !BؘX Z!H p80 8BHCPZ!x$Bx^:P8;@Cp@$!~F}S05`C px8@ pp<@`p`XZ!H $X,PZ! p$0 XZ!B`U p$B*Hx!@H x^ 9@PX9P8;BJ x$BPp! B0H9pClP89pC!oPH!BXoPZ!` C`C`pC`C``C`00C`CpJ!` (@B0J90C<P09CpL!`@(@B0L90CP!BpN!`(@B0N90CP!B``(`B0P9PCnP!B@x!P09pC`C8@9 C p @!80 pxLP@BJ@!D. H p$8B@ p<0 Hp$ Hx$ \@p! @Hx$ \@p! 0`H D. PHx$ \@p!   HD. Hx$ "\@p! (Hp$Hp$Hp$Hp!PZ!Hp$PZ!Hp!hPZ!Hp$HPZ!pHp!x}PZ!@Hp$X}PZ!HHlPZ!HpT!x#X!BPH$XpBXZ! B( p$0 #PZ!0R9BKhjPHp$B`p\#PHp$B`p\X#PpH0-pB @@!H2P89C@!{PN! B 89C@!$B@PXpBB@ Ta$p8 rTH!C BHB B  PD@B HR80  00 hX0@1B Y,0C pB 80 89J pB 80 09@C@B!hP@!B`( @$0 XN!H@$B@PH!P@$B`(@$B@PHXH @B@ (@!/PH!`B@ !*H(`ChgP0!B(P@!B08 P@$B0 0B xP89B @!@C!@ !U ,PF!` b !H ,v$PCU  ppX 8 8B "@B pP0  &PF! Hԑ xv$8 8 H 0B 8P89B @!@C!@ !U h+PF!` bpK$H BؑU (@@C ppX 8 8B "@B p@80 x%PF! Hԑ xv$8 8 H H u$b` x! 89@H0B x@80 x0C@@U P@@B  @B@ (@!H!PH!` s!Cp$B !0 p @!p C p80 (B!@PH!p rx$PBfpC @<B @ 0(`phx!B@!U (JP x$B0@!(-H0!@b !0 09C0@9Cp@s$BH@ !0  pD8 sXL! B @ @$0 $XL!PBpD 09@!B0B ppP@C@$B@Ph$XL!PBpD 09@!B0B ppPCH$`rPCpFB@U08@80 0CXL!@!?P  @$0 +PL!@H@!BhPH@!$B u@PiXL! #H@A$"H@@PiXL! #H`H p$b`(H !0 09@8PC p$0# *PF!U xX F!0# p$@80 x*PF!U XE3~Fxs$fb p!8 09PB P@$B߂ XU `@! s$@B/P X!HxBBH'P8;`C!"s`00E9K$JXP@Hpp$"I D!<B "!8  xB@0 89@Hx$xBx0B p`8s0 . 8@9BPC p@80  ppP89@B p!8 8(p C p@80 X09BC p@80 p@!BP09BB` PCpF!XX!oPa`Cp@!`(B( P !B@p!`CxF!PX!` CpH!H <x XX! XpB XX! B p$0 P`Hp$ sp\ X09B0Kp@0B ؑq$P B "<BH !80 (xA!X89@C!Bp! pBpP 8!xPX!B@ e$H BXX!BP09CxB!SH XX!BaxX!B$ B@J xq$<Bp 09J pJpP09 p $PJH $D0  X89CpB Bp0a"HHp@!X X09BpK ! BHP09B@JpH!(XX!Hp$`Bp\ X89B@p$ p\P! H0D9B0B1rP XX!pH!BFxXpRB1r889 pBH p$0 P`H()0 HȂ!$`B p!8 8BX(P L!H8@!BP8;C@@9009pCBJPL!@$(U@ BpBP@@9BG`J pv$ 8B@D 09@CpB 09PC!` r@K8!h XL!pB U pDH0C@(XL! p$80 8BX XL!p0 HX09BJXX8BXL! B@8Nh P0H 8A$p0 PL!H8!B~PH85H @!`b (!0 89`CXJBX!BEP!BX!}PP!` rpCp0 B < ! Bu 8(pX0CHXP!D!@ Hxq$d p!8 89pB0H9`BxXx!H @8Ox8U`  8BCXX89BB0H9`CPJ 0T90CJx$Ox8U` P!HuP@HCx!Ox8U`  Pa$0 PP!` rKP!H <XHXP!`Hp$BE XXP!HXP!HxXP!@ B@ H (BXP!BhX89BHJXX09B0KP!B5 (X0Hp$HXXP!H % PB` 0@!xX0! B 0L!H`|) 0L!0YX!B8!hP0;B8B!zH0AH3 C010BXJ!B U0 @!@$(-0B@0!pfP L!zHHBBHP8;C@9P1`"spC $ P1""HJH PL!H?P HBBP$BG@9pJx$B p!80 !@!p K0D90BpB0B@P B@C@ 8@9C!@!B pB80 P B@J pB80  P@BJ0F9(Up!8B  xs$"s0C p!8 09C @=$0 XiXL!0C(Xa!0 B 0 @@!0 H~XL!!B@@ HF!BB  x"@0# pD@0 !y8 p@!xD # 0  p 8@8 iXL!BXL! B @PiX@B!B (U@  p=$ 80 @D!XX!` r 0@!CXL!H@ H=$0 XX@!B X!BpL$B@hXL!xP89B @ HzHHx XL!`rK@B!:H  HRhXL!H @=$0  PL!HPH@zH` 0@9PB p@zHpC  XF!`rH p=$P80 XF!U  !XF!U ! PB 8!@B@xXH!` r @ (y$zHt0 BB 8$P8BX!B(!` BX@@!B0XH!P B 0!=$`0 XH!U XEA0B ``?#B@ hH"?A/ "/A/ "A/ "A#(XX! B @H H0 xR!X X!H p!8 89Cx$B p!80 0`90B p`pP09C x@!pP0BXxPBXX!hTPdXX! B pPHx^xXX!HpPXXX!BapPXxPBXX!hTPd@ I !bp!H x 80  0 9`@BPB@H x P80 xP09 "Cx@$PH @<B (J80  p!`80 XF!@0 8XF!U  @X F!@0 x@$PH p!P0  p9B0xXF!@0 XF!U  0B 0@90AU  a $@0 XF!@HX 0B PF!@B ((JX P0;B0CXF!H@!U @H  p8BH H  p8BxH H  p8B8H H  p8BH @H  p8BH H  p8BxH H  p8B8H H  p8BH @H  p8BH H  p8BxH  B0@9H,@!@Cp  $p r !80  Hx  $p r  <0  !  H H  p8BH p` $H<0 HH @H@!H0C   H   H % `B ! b @B!PH!U @ p !80 8@9@BHDH!PH` I?#f A B90:d H b2!pb@p0LG9B0@9C pF80 XX!B%`JXpFB`@`hX@B D r80 BC !@!d I?# 0LG9@J pD0 098B JXR!0#H2xtp@C0B9CW8 ps$ 8BXDXXR!B(nX DBJxPR!W8p0$ @p0$ xr$a I ؑ 0$<B p`8sp  p. `Bxa I p"px8 pp$ 8\@8$ p 8\@8  ! 3~Fx@!0b%(! 8@B Cp 09@B x< 8(rC!@!p0BB 0D0 09@C0!jX89B`B0D0LxXJ!`sAX|XJ!0@XJ! p@!80 @a p!8 8(pp!J ppP 80 @@ 9H0 $(X  3~F !`r@`Cp 09@B x< 8(r@C8@9BBax0<B@C pBP80 0J9@ChX89BCpB (p rp Q80 HXH!HU `@!(@Xx@!B p8B0a p!8 8(pp!J ppP89 @Hx@B@ ! B  !B~F8 pp@(C p  :~F8H0 @'`B@!@(  p  :~F8H0 @' x@>~Fx8 ppJ0"9<( B89@'(1 H@ ؑ0!@b p!8  0H# ؑPB8DB8p $ CDpBp@HHQ$ 89PBHX BBp0 X89C8BX8!BH$X8!B@BxXL!(U@ p $jH B8XL!H0@90C p@pP890BH{X!BhX8BXL! B `r$BHx !H @P@0  Pp80 xXL!B  8B8X L!BBH % ZH@ ؑp $H0b 0 09`8BC0@!hX0!B@$X0!BHX DB@8XJ!`BX0!B@$8X0!BX DB@xU$PO@!X@`EH B, f12(HX`!p B Б p!8 ?#@H0,0C0!x$@ pLx8@ 0 9`CG?# 80CpL,H p< 80 0 9JpP ! 0Bp 89Jp !@<BXER9`.s8Y T9H`A $ 80 B aD! 0 X09BB B xd8(xP8<8CD pL 9@ p@8Bp 88DP`Jp`D! `B x@ 80 xP pdpP888J@!@B(X89B`Jp$89@J0K{ `C(F!0J pZ 0 `09BX`!Opp`D!0BP89Bp!@H@!@ ,(X89B(% H@J!pX0BxX0H% @B@8@9@C p80  x@xP89B 8 Bx@>~F8 pC!<(r`C01PB09@B090CU 8H09C09   BH(@!x\X09Bx@@J(@!`B@!hXH!U Б p!8 080 @?O xt$<B@U xt$ p!HhM 3~F` $Bp$p r(a $`H ؑ  $0C !@!80  pB80 [X09Bp@pB HX\!@ 8@9C!@!0B pB80 ZX09BC x@!<0  88~F8p: PJ p@!8 ! XpB @8(@p8L9C8TE9CpNBr@ B! BXH pB80  X8;B @HpKXpHJ B@v(X89PJ8TE90JLB@vX89BJ@ 8@9J@V!`apq$ H , H $PH,P $BE0!@B Xp4 h\! BpP!p: C8TA9C pLp8 sp@C 8E90 p !0 X\!D! 8E10AD!( XpB @8(p8L9@JP B@v(X89J8TA9JRB@vX89@J pLp8 sp,J H! B TX0 H1р)ABXHpLd89 C8H9J)$hX@V!B hU `@!H5PBԑP!B p!8 ?#H A  p<(Q 0{R x< 1xxRp8 @<<)`0M pF8B ppP@8N  8P!@xD B{R x< 1xxRp8 @<<)`0M pF8B ppP@8N  890BX89@C 8!~F 8J0`Jp@ p F!80 09BPC p pPp, 0B p8B `8s@F! B@!HU PB !bXF!` rx@$U p!@ B@80#@ !P H !b8XF!` rx@$U p!@ B@80#@ !PB !bXF!` r x@$<BA @ B0B p`pP@ !U  0 B bp0 !8  p xP8(p890BXH!U PHԑxu$ B !<B 0@8    YXD!U B@   Hȑ ! b0p!H  (8 09 CH@hX@$B0a*3~F@ !B` A!0Bb H #Pf!!R$PBlP8;0Cx$!~F a @5<B}S ppX9 s hЀHDB@C px8@ pp<@`p`Xf!H ax@s$`CHp!@  l<\@< H<P8;BJ$`B p !80 !@!p  C0F9 HARH`BpDB=P09pC@ 8@9 C!@!`B pDP80 x=P09BJpD BXf!Hp Hp88 pHp  p. H8B9 F!0Hp  p@. Hp p . Hp  p. `Hp  BHxr$PB p!8 09 B pH`pPp, Bp8P  09pBX89B`@BqcXC pH`pPBB! CX!B@@! C!B pD pP0B p" pP0CpH 8 9C xH@ a p< D  x-"x8@8 RPBFȟX@BpC!@!pB p!0 8X!pH RXpDB@X!B@NX9B m$d0@X+r`8+12!X09B8 HKX89BJB! BXf!PBRHpH0B`pPJ8F9CF!0B pD pP0B p pPCpJIp00(!PC pJ pPCB!p3H` HP9 PB pH@pP0B pJ@pPPB@B pLpP89`Ch$ @!@ ` 8C 0B pH@pP0B pJ@pPCxH0Bp pDx8@ x"?ZDp<  8DCpl$`sBL!PB8C8NHX!BNpH BB1p090B pDrPPCB!0Xf!PBF HJL!PB8Xf!pH pJ@pPPJR$`B`XjXf!PBvpHB!XH x@!< 89J0T9 @FC!hXf!HB! BXf!PBHR$`B`XjXf!PB&HF!X!B@B@HL!`KHȿX09JHL!PBX H(!F!P0 hX09B CJ 0j9@BX!Bv RX!BJX(!BF`BX!@!BxDB( RpcHx8 @  pp@ cp8p p #8Xf! pD9@8DHB!HXf!PHRP Hv X(!BHp F!PBXf!HL!PBhXH8X9 @$J 8V@! aXV!H0B9P CH 8l9BPf! $D0 Xf!B0HB!X!B@JpHPBApp8P  09pBXf!0 BHT!PB#P0H!X09B Kp  B89`CpX!BG0!`C8$0 x"PJ!`BxGXJ! U0 X@X0B?XJ! B 8@`8H0LXHXH0@`HXA2~F@h$B a@!bhZEX X!Hԑ!$`H 8!@<BpN 01"pC(!pJ,Hx$ 09@ `C xHp<&@@ @!8B ppP pHH# x< @# x!<0 3XX!#ahF8XX!`ChA!0 CX81C% A?#HpBx;XX!p sJpN B rJ`PCXU `!xXxH, ` hR!@ @%p8 @ @a p@!8 `8( pHH# x< @# x!<0 1XX!#ahF6XX!`(Jh)$xBXX!pN B rJ`(Jh)$(BXX!XU `!()3~F 0!@b8]PL!@'$pB@PxTP8;CpI$ ~F}S0X5@C px8@ pp<@`p`hFXL!H(U@ `@!@'$pB D@PSP8;BPJx$xX@ 05<B@@8N B0 9C8CXL!HPHAB. H B. HB. H!B. pH p$8B <0 PHC. @HB. 0H``C8@!`@(PB0@90CPL!@!pH8@!`P(pB0@9K PL!0HPL!p r`JHpX!B8!p rJ U0 `@!!  bd !p s(0CU hH!Xp!B@!!K p Ap P`8(pC0@9PBKXXH!pH p$`80 ~XH!0H(BhXH!pH@ p$`80 |X(!B0B8X!B@H p r$8B ԑx!H  8@53~F H!f A8pbC18HP R!MD !0<B``D!P@9BGPB@X@!BHP8;C@9JhXpFBs@HW8a(!` 0C p @!80   <(rCD!<(p!A 0 ȃ09ApD@BpP!p8 pC8B9B@x@ p !p< pC p80 0X9PC pXpP090B09 C09BD!O X R! 8(p!C8B9C8C9 K`F!؉X8;CD!P H pDpP!p8 sJ@ @9J2xtp00C0J9PBHX @XR!@!W8a!BX09BJ@ pD!8 8(pH 0J pD!8 8(pH@X@! HXR!HxXH p@!8B 9#!aXR!(XR!XR!HHH9@Pb $AJX$ZHHX($B`e`$(X@9BHpQ"@B@!BbxP ^!B2HBBȺP8;C@909`C$JجX^!HhBB8P$BaG$8;Jx$"sp! Cpq$p CF9P(s)*!H  d8!@B` dP$B2H d !80  @B@B!HXp!p r xp@B p@9@ 0!BRCp!` rCF B)T40  p pPC H!X^!@ 8@9Cp @! Bp  C0BpN 89 B 0BB!"X89CB!JhXpHB!X09B`JB! HX0! H xL0HB!@ BXHX`sB B!@pP0C H!X`H! BX8;ƒ 8; 0JG @C JB! XHB!X^!H $0 8X^!HHB!0BX^!@HB!XH8H9pUp!8B hP H!bPF!U PH!b8PF!U Y&B@(!B@ !`BhP b!0rHF0BP8;C@901#sC@9`B($JXb!Hx090BCFKP8;BaF$PJ x$<B 0@9C` ̑xH8`s B`#p @!p pCH9`.s L9ZDptH CD!Xz!@!B 89Cr< r H9@8@ 8@9C p @!80  pJD!XX90 B  D!@XP,!r18XpJ B@V!B B8@0#CX !@B !8DX!B`@X09B`  @с BXb!0BXhnXb! pJ 8#D!@B0 P@BpJ8P9 @$J8T9Up!8B/ x $H0$HDa BئXRT!BHD!XX89@H D!Z BXH p B, p@09BX0 B9B@C,"` (0B (J!` sC,"0H9HKp`v$ H(E@H0B8!p PC (`@0 Bz!B p@pP`C F!Y p8H 80 89Cx! z!Jp0 B !9@09JpN @ 8`(9p(!PCPb!@HX !BpH$H!:$0BFhjXb!H(-3~F`xq$pfB9@b0B p!8 89@B @! ` @#ap1 H8"`0@Y@1 qpp<#P@,cxDHH8`@Y@1 qpp<#P@,cxDH8`@Y@1 qp$B@!,A đ 0D98@  p08Bp!0Cp 89Bp @! H@ @@80 hX@!BX2xtpaL! 8F90B p pP89Cq$0B p"!8 89Bp@:$`#a@tHHHX L! q$` 8C8D9PC`08(@Bp"!0Bp 89B pB`pP C`8C p @!80  8PtH@(IPL!0 B@@ H@BtH@PHXL!B@E p :$80 fXL!@!?P a@@XH@@! H8XH@!0B xB@xP@c8"`0<(J,`x@ 0H8pH0F9@ I@a€tHp 0 H<BJ @:$80 @PXpH p @!0 @H؏X@!BH! ` H  ! bHXH!@!B09C`v$H@ 8B!8  ! HqPpB p"H0 088pCp  088PCXH!B@!U 0$H81B0D9BBX!B8D9rCxFABp@ px8@8p@ #pB ppP Bp @B p@s$8B p8B88U` H@!(X !B@!C pHrPB !!0 0R9`BXXP!jH @ p :$P80 PJ!`XH!BP@(X!BHFBX!OBxH@`P!0 B  PJ!p<@`e p"@  p< pD # pH8@ 8HD pHpD #pH px8@8HhaXP!pHp :$ H` (BX_X!BHH@!BXp!B@!``Cp 09@!BJxx@  <HH@!BHXp!B`@ $ xHH=B P!beX!B@pB8 0@CXT! ,D8 D0PB p!8 09C@$HU @pD!H@('$ 01"C !@8B0!H!pBB`L 0X9C H!8 x !<0 8 <BH F`rNpCpD! ~FpJ@!HU @hJrHX^XT!`H !@!0 `X`!H PhJ8\XpBB@hȁXpFB N80 8F0#XT!Hp @!NH p0 `XT!H H !b p!8 890BXD!` PCXD!XD!U XD!țXD!U  % PB` 0@!ȓXJ!` C 8$"Ip!H <B8@9`Ap 09@BB `0 X09BPC0BhXJ!H U0  p v$8 09Cp0v$`BxH p`0 89@B@B pp80 X`H !@!0 0XJ!"H@ 8<$p0 XXpBB@8h~XJ! B `BXJ!pB0Xp@BpC(XJ!`BX!BX@B!B@ p @!80 0XJ! B@0K p<$ 80 0D!XJ!pB0Xp@BpJhXJ!pB \0X J!0@p HxXJ!H 0<$`0 xXJ!؍XJ!@$H0H p$b@ XD!U  ! B (!0bhP J! RH8D`BP8;`C@98D`PCB!xP@9BGJp$H x!@B 8 0@!p8 C8B9PBX J!@H p!8 09Cp`$`H8XJ!pH Б p$@B `< vX@!B@X@$B@ 0)$`0 X@$B@ 0)$`0 XH % 3~F @(!p ra0@!0bp!CXp@!B @ 8!`8 IXJ!  B @=$pBXH8NUXJ!B U0 `@!pHp ppP8l9J 0,$< 0L8(pJHXJ!HpH ! 3zF!`B`X09H (0!`C8A!tXJ!`OtXJ!p0B `0 8PJ!`H8Bh{XJ!p1B0BPJ!`RH8B({XJ!pB0BPJ!`H8BzX J!0Bp1BxP J!8B`RHzXJ!B@! U0 `!8- B` (!BP P!lHPBB8P8;C09`C09 D!JHX@$Bp0PBBPF!BGJx$` C !p s p!80 p @!`rC p@80 0H9C xHxP09B89@B pH!8 8(pBHH!X0;cpC8@9PB@0F9PC@ 8@9C !@!0 H(X8;`C! 0F9pC0F1J0F9JH!BHX@BpJ@J!8U` 8U` @H! HȞXP!8U` xH@<(p $J89pJ pH!8 8(p$@HpBP HHXHH!XP!)`J pR$80  x< <0  p8 `H!(XPH xp$<Bp 09JHD!P$XHH $Hxp$H p!8  0@HÁ PH0-,J 8!<BY x< <0 8P9`C0P9 !0CH-P!B@@!hX B@@( p8L9C8C9`C xq$<Bp 09( B8L9`Cp6$p r  PD!80ܐH8pXN!`r@C@F!H ܐHRKXN!0UP HA7$ B@uHRxwX89BJp`7$p r  P@!80ܐHxoX@HH7$B@uHRwX89B@%HH7$B@5HRvXN!p sJHF!Bؐ 8F980ܐHH(!p r 0!@bcPB@X@BC !@!0 8X8!BGJpD0 H8X@BJ@F!(U@ !8B! B(X8C1H(U@ Y(`Hx @!0f B(@!C p80  ppP09C8Pd!J$@BjxP8;pCp@($!~F}S05C px8@ pp<@`p` !H (h$H` ( p$HpH H p 8B DQ!p; C8B9(pC!p; C8B9(C89C(rC(J p J!`rK !80  p8 8(r@K pH80  !0 ( p89JP@BqX89BJ pH80  p!h9# pH80 p! HR@BXqX89( J!p; sJT@BqX89B`J pH80 p! PHV@BpX89( J89J q09pB pD!8 pP?# 09@B pD!8  pP?#`8sp D8 89J pH80 p! PHX@BoX89B%HyXd!HJ$@\@0,"P0 P8;BJx$PB p!80 19 BBC pD@80 P!B@B@p:@C!@!PB pD@80 (P!B@JJpDp:@{X@BpJ x$<0 rX 0N9BpB @!p@L. 0,"H0M. H0L. HpL. HH=`BB, f@ B,  8F9bC8F90CpC,  89C`@!p sBؘX09B`B`0 (`XC`C` CH9P B`@!HX09C0H9 C8F9pB`@!oX09BPCpPB,  B`P`J$ `XPC` C09 ChJ$BEhZx@XT!@$_@`@!~F8 p@CpR 09<( B09CpR 890C p@pP89C@!KX`!Hp!A1B p80 b <@0 8 9C x!<0  p !80    p@?#p@0$5J@!1B8X`!` sC V0 -pCxgX`! HT!1B8?X`!HP.X`!B>X`!B@@ !0 (1X!2B"0 \X`! B`CpX 8 0 ,@B xZp<$@p 89Cx!`wPC x@<B p80 XJX `!0  $1B@(0X!2B 0  A1BD A1B  8 9PJt$0Bc !DB p p< # @8t0( `80t0(  @8Pt) U0@8pt) |H*p0( P@:p0(p@:P@ x@8t0(`80u9P 8Pu9 8u9 80u9 8Pu9 8pu9 8u9 Ѐ8u9 8u98t1fxfX`!0B!2B @`! t$DB<p0( @: p0( `:@p) (@:U0@8pt) |H*p0( P@:p0(p@:P@ x@8t0(`80u9P 8Pu9 8u9 80u9 8Pu9 8pu9 8u9 Ѐ8u9 8u98t1fP!B/,X`!BhvXH!FX`H@!DX@!2B p 0 8\Hpv$H x!@B9 #  b (@!XX09BB(@!`BGXp!B@x!0C p pP Bx$@!U (@!CX@$B0@93~F@p B!f 0@1pbCAB!~F P0  pHpP yȈ "r!"Jad8 1C !0 89BpF 89@BP@ p8F 80 890CD! 0$D1,JXF!JPR!B`hH!EP!B zv$H` `9d<B x !0 )<  0$18Bb !zHPBpx1Bb`QX <#b p!p<#XDXR!p C8G;C8G;`C8G;B`&$BPB`XXR!0B`@v$8B`x ! x0  <8#CXR!BW8bE?#L,@,pLPX M)S p8 xS p8 p@ @(::)x8 p8 s@xL 08B{<$JXa&$@XVBXR!p s`J xv$<Bp 89B ppP 81c8G;J`&$B`XX@$Bூ @Up `!% B  !0 89@BP@ p8F 80 890CD! 0$D1,JB 8 90C  BJXD! BPpF B H89 `!C D!Bx , x<@ a$@Yp 8pCp  89PC x x@@ x<@ `HcYpa$@Y8JB 8 9`Cp !`$@@ Ypp@ rp 8Jp@ BHEPR!BhH!?PR!0 B` h=$LH`XxXR!PHXB!DPR!B  B"J p !80 8B>P!BBH`&$B`XhXRa0B`@!vdBLȈp0z !J X&$0 OXHxv$BLH p!0 `(>Xp@!B`( `!9+XR!W8b`&$B`XXX!B H5XR!HH % 3~F (!0bAKPJ!`B8N(CPJ!`#C 8A!"I !0 0@!( #$PB@H X89BcF0C`(@0l9Jp@C?#pP `C8 p@C F!  p@C?#p@8$5J(r`CPF!@B|H QB!`s`CB!P0 X89BcF0C(@0B9J8D9 ` AB?#`Bp pD pPp!0B<$H}ST#A px8@ pp<@`p`p` I 0H8^0 8<4CZXh! `HF!` Ha !PBhPx@! ,  Z0!@0~FQH$pHXh!@$Ha$`|HV B`0 xXh!0#BH F! (rp@C?#C8 ppK F!  p@C?#p@8$5J0HF!p HHP@!BFHF!P HPH!BFH a>$P0 (Xh!@H@xD 884CZhX@$B0ePh! B0 $`|Hl8Ph!`sB0J9 Шa`CB!hXh! ,B x@!p#p 8DHP0H!Ph!PB B`C|HlHPh!`spBp!P B(P! C 0B0831BhXHXP!B@P09B0BB!`BxP09BK!P BxX!B0B!B HxPh!PB A>$`0 XXh! HhP09BKp BpP09J!X09BAB!`BX!XHPh!`s@PB0J9 ШLa`C!X HxPh!`sB 0JQ@R 0CL!`B!H a!P0BP!B@H # X!PB J!B P!B@!pCL!B HHXPh!PBv A>$`0 8Xh!pJ 09H$@H pDpx8 haa|pJ@H0J9 a@J!`BX0H0J9 ѨLa BJL!`B@H0J92BB0BP BH @2BH0J9PBBR!pHB!PH0B2B@ p80 eX@HL!` BX Ha$`|H B`0 8Xh!0#BH!`BHB!XH>$`Bj Xh!@H@ xDpp< haa|pJ0Hp!P B@BpBXXHL!`BH!(XHB!8Xh!@H@ pDpx8 haa|60H@H !bXF!` B >$@0 ( XF!U `AB0B9b`CpBB 'pP890B 0@0Q89| 8a 8P((X89pCHJ9@a H8 0@0QxJ!XX89B *!Jp@M?#pP C8 pB@!~F 0@~F08 pC@!H"@xP p8 ` up@M?#Bp@8$5J@@@!p a @ @0@(rC0D0H@%`,CP 0PJ @ 8QB=)J  0J1@C(K?#HxLhXZ!`cJp$``C !`80 xL, p 8 (XZ!`aJ00`Bp$P @0(K?#HxLXZ!p sJ`U  @! <(r!>~C 8 `K0$5PJx@ B~F}8 p K@!<(!E p8 @u p@?#p@8$5JH0%@B 8!(8(u!$H}Bpx)p pp<@`p`XX@B!! @H HS p8 8 pH  09Cx?# 8;C p|"?#&@p@ 05Pp@  ?#E~PB8 PpD(Pp@8t@?# H! )@ p8@090J89B @?$0 XN! pp$B`8D(p,$8D@@ 0UP p$$Hp4$Hp($Hp0$Hpl$H 0FH8FJ0Hp $PHp$@HHpA sxH8 ppCx?# 8;C H!D( p@  u p@#?#p@05@C8;J @0B9@J@DpH893~F 0@9B0C p@pP89`C0D9BD`rFOp0ap@>$ B (Q!"r@PYX8Xx@0B @ ! B<(pC< p: pCH8`0 (XJ!` (Jp@$`B>H8`0 XJ!``(Jp`$`B>H8`0 XJ!`p(Jp$`B>H8`0 XJ!`(Jp$`B>H8`0 hXJ!`(Jp$`B>H8`0 8XJ!`Ј(pJp$`B>H8`0 XJ!`(PJp$`B>H8`0 ؿXJ!` (0Jp $`B>H8`0 XJ!`0(Jp@$`B>H8`0 xXJ!`@(Jp`$`B>H8`0 HXJ!`P(Jp$`B>H8`0 Xp`B!B0 0L9J{PJ!  B@0$p>H0Lp0 XJ!`BU p`$p80 XXpB!B0 0L9 JhzPJ!  B@0$p>H0Lp0 XJ!`Be p`$p80 XpB!B0 0L9JyPJ!  B@0$p@H0Lp0 hXJ!`Bu p`$p80 XpB!B0 0L9 J(yPJ!  B@0$pB@H0Lp0 ȼXJ!`B p`$p80 xXp C!B0 0L9JxPJ!  B@0$p@H0Lp0 (XJ!H p`$p80 ؗXpB!B@ 0P9 J0$p@H0Lp0 XpC!B@ 0P9J0$p@H0Lp0 XXJ!`B(X@!B@B 0 xH @dH !080 XD!U (%0Bt!@!p r@bC 0 8X09B@!C pBp80 X@BC !@!0 8X@!B@8D!JpB0 H@HX@BJ@F!(U@ hQ3~F !I X$BI (a$ I aA!Bx@!bC R!0#d0#N0#P0#J0#X\!H@D888 @$pCp$!p C p @!`r0C p`8r B p $80 pN 090CpT 09PCX@!H@ xD B@8 Bx xRH0 p@!8 xD0pC xJ@0# "0^9 @!C xL@0# "0^9 @!0C xP@0# #0^9 @!C xN@0# #0^9 @!C xT@0# $0^9 @!PC xV@0# $0^9 @!C $B !0B` B0 HuXp0!B@@@ 90Cp 890B pR pPPCpBpD 09`B0Bp 09pCxD!KP\!xH!(~X\!BhU `@!@!hU `@! x $0 (YX\!H(X\!+H@ p`$80 hXx!BVX\!HX\!#H@ `$H0 Xx!BTX\!`HHX\!H@ x`$<0 Xx!BNX\!HؾX\!H@ p`$80 Xx!BPX\! HhX\! H@ `$H0 Xx!BL8X\!HX\!H@ x`$<0 8Xx!BJȱX\!HX\!H@ p`$80 ȋXx!BDXX\!@H x $0 UX\!Hp$BP!B@/X!Bh\P\!r`HxD!BVP!BH85f@!`b0C p@pP89@C@!Op0P@!HXP!` r@C !BIP@ 0T9pC!B! B PB`r@!pC D0  8U` X-$HXVhXP!HXP!H@@ X-$0 HXP!BXBخXP!@Hxr$B@ !<Bp 09CXXP!0 B@Dp$, (0 p 89=$@%BpB x@8BxP ppP888pC H!0 ,@p p8 80 89`Kp ,!pHhX89BJ pJ9$@ pp@ ppP89 @!@JHP@!Xp!` r @K ppPp ! @8%`HH ! @B@0@9PB0A p@pP89PCX'H 8U7XH! , pB 8 8(sKxXH!pH@ p-$`80 X(!BHX0!B B@L(X!p r  HOp U p< 8\@8 X$ ! pH0@9`B`PA p@pP090BX89`CXpX$B 8@"! U0 8D9`C89pCp!O  x<@x.  <H0@!XXJ!H0@!pBX89#H0HPH`0@9@B PA p@pP090B8X89`CXpX$B8@!U  @!XF!BH@H ܑ!b p@p8!X 01B p@ # 8@ @ H ܑ!b p@p8!XF!@0# !`jH(A3$b`(JX(!B0$pHXF!U  - pRH@(!0b@B!BPJ! U0 ) 3~FeH!`RH8A!PB@P!B@8XH!pH@ 0X$`0 xX(!BXH!U `! - pRH@(!0b@B!B؆PJ! U0 ) 3~FUH!$`RH8A!PB@xP!B@XH!p:H@ pX$`80 HX(!BؤXH!U `!()`B @B!BX!B`B@8@!B X!B@CȪXpB@pJ@F!(U@ 0-@B8!@@!B@ H!X!BH@!pCXpc 8 A'p 8 s!J0UP @F!0UP ()H@ p$0I8@!@b@!0 pF 0888r!`BX01B@D FpC Fp$`r x0 x88Bxx#8D@ !(U@ p`$I<0# %  H@ a$PB0b pB0 p8  81p8 @0CXJ!D0#@  b (@!`BXH!U ! ` H@ !PBȦXH!U @B p$0B (! p!XF!@ H (!X p$B 8@@B p$0B (! p!XF!@ H (!XF! # p$`I H@98 89Ƀ8@98„@! @!\@!H x@@aB`b @!pH# x8 P  x,"L# <"CXDp"y@@@((8\@qt8"2~Fp$I@A!b p@<B89pC8XD!00BX8 0B!0C A!Xx!B@!U `!1@!B p@8XD8@2~Fp$I@A!b p@<B89pC8XD!00BxX8 0B!0C A!Xx!B@!U `!p@O p|,"p + p@9\@p<  8@2~Fp$I@A!b p@<B89pCXD!00BXX8 0B!0C A!Xx!B@!U `!1@!B p@;XD8@2~Fp$I@A!b p@<B89pCXD!00BxX8 0B!0C A!Xx!B@!U `!b` @!hXp!B880U0CHU 2~Fp$I@A!b p@<B89pCXD!00BX8 0B!0C A!xXx!B@!U `!3~Fx!P0B` @!`<B  !p< #bXX8 0@C$@@!U `!XpB aq 0`%JH@92~Fa xP!p s `P@!pb` @< # x`!80+d @< # @80+HX09C!!2B a;$00 pF!@B8F9`C F!8 ` < ؛X(!Bp`F! C`AF! Bp@BB `X8B8@ؕX8 0BCpHBp0CXR!H 8F9pCpF!@B F!8 ` < ؚX(!B`AF! BJpH 09pHPLx;XR!0 XR!P'@T!@Up `!X!@ HPD:XR!BXR!0 xXR! #HPBXXR! PJ!B8d8; CX`!B` P;$0 8XR!XpX$B@8HP'(X`!B`H H ()`B 8@!xXL!H@ p;$080 @F!mX!B@@@!HX%D!B8B!hXH@!B@@@! p;$pA  @(X!B@F!ZHnXL!B(U@ 8H6XL!OHx DAB p B0 p pB 8 @ 8D0#<@x?# I"0#"x0#x B AB p Dy8@ xB0 < I x{xH0#D@$0# % 3~F8B!Ba0bxXx @p1B`bJ!B p@x0#86p@!0BgH01ׂCզa88k) g08`xX`CpNX"@p8 C x6p0 @<@y<"@DP P @R`S)R  w p 1R8b)x pd p0#a  w 0PA! @T ҉R `wD  01!@0)MZ)`2 h" A! X@RR)@" @&  "S)  p8  pL$@Sp)x<$ @8 @P6x)RyT8J!pX, `B@g08,0 xN0B@fffffq0c88ax1<?) awpQpRp8p0#0p@! аPJ8N0B8@!0B0xPJ! U0 `!p @ׂCզa8<p0# @`1R `w xQzR x< S @ Sp8   p8`1Ulb8<p) q"!E)X 08 `t ptdR 8" D"@@ x"!p8"@ p8 p$@@ HXp@B@ p 80 cX JB 2PPJp$ B8@!@C, Y00z$@H pB9@p h!`8pC D!@0# 0N0CpB, Y @!0z$@H p 80 098BJD!@ BnXh!B0x$=XpBB@ p 80 bX JB :PPJx0P!,@p8" XU  H9`B8@9 C 0B98 (Q8 0J9@C@@!HU  !B) !X T!(!, 0z$@Y0C80 B1r 0A" 80 X!`8pC H!@0#@0J0CpB,Y @!0z$@H p 80 098BJ H! BlXX!B8h$:XpBB`@ p 80 X`X LB@*@PJx0@!,H 0H0B90CB!HU hH@!HpQ"f@0@9BB!C @ 0H9BpT 89B0B9C pBpP09BB ppP09B`B ppP09 @ $0BjX@!B0D9BC pDpP09BB ppP09B#`B ppP09 H $0BiXH!BpP pB@@MR9 890,`@YBpT 01C`$@ 0b9B pbpP09BB ppP09B`B ppP09 0 $0BhX0!BL B`F R  B,6X(! 0Cp@0$@TZH!9@X\X^!@Cp@ B` 8N!9@88X p@ x !9@pzC0,1"I 0b9`J0! B`F L @ b! Y5X(!B J! BX[Xp@0$@TZ ^!B1r([X^!JD!, FZX^!H@@!hH!H@!H85 B`@!@BH 8@9 rCpF 01C(p@,` PJa0 @ p< 80 8ZXpFB rJOp0(! B`8@9`BCpF 01Cx@,@ p8 p80  p B2,h8 00CpF 00J(U@ `B 0@90BPCp 090Bp@  !p8 r0CU XPF!U 853~F@!p r%H@!`bChjXP!P B`E HA$HTP2X !B PB!BaPx@!B P!<  @ (9 #@ #@H!8U` `@!1FH % B`0@9PB@D!0Cp@ 0!p8 r0C U0 x PJ! U0 `BH  ($0BY  P0 0XF!U % H @ !PBY0 b81XH!U p@Bp @!@X p8@ 80 89 @!@X p8@ 80 89J % B8@90bCp@PBpp$Cp<@  B @%$`80 0XJ!,p p8@ 80 89J U0 0B 8@9@`CXF!`H p$P80 (0XF!U 81B`8@9`bCp@B 89@ CxB ($@xP B pDpP88C F!Y!p$@p 89Cp@@ B B pDpP88JYX89BpJ8D9 pC,D@ HBH, p p$@ 8 <0 89JHD!B`u8.XP!H @@!8U` 81@B @!`b XP! B`p$, H (B+Xp@B`@89 x!Cx!= @ B@ F 0 \XH!B@(X-$(+XH!BPDPX B, @ p<@ 80 89pJp!$I@ ܑ 8 !$I` ܑ>!$I@ܑ0(!Hܑ !@tB>!@H @x$B PA@!€Bh@!BE@!B@X0A! B`@A!BB A! B``A<PB:@P ,` 2l 40L  .@0 xp0  pPT0 " H0  @Tp0# B@Y080@, "!C pH 9$@XdXpF0 8 D0UpX p!D$@p8F8,Hp ( 90+@$J$@@HdXFB H0  ,@$rHcXpF0 8 D0UpX p!D$@p8F8,Hp ( 90+(%Bq$@bpF 09KB !0 89KC  B8Bp< B p8B <0 8XL!,p p8B 80 89J p $8B8F= #(U@ 01B` !pBXN!B H !0  pp8 r!@! !@C80 !CpH$@ Y< 9$@ 80  89@0 @8 Cp@!B80J QF! YH aXpH$@ Y!Bpp x@ 80  89@0 @8 `Jp$B P!$80 HX@D!B`(H!0epU_Xx!B p !<#yH p $ B * p !<#y@HU0   0B @e8Xp$B pUpD@ @  80 @@ 8HU@   B0eXD!@ p@$80 !8@p$ BG< !0PB  ! p<0#8 pD0#L$@ p@$@ (B *p8@U0    H 8@9PB0bC pBpP098c`C0y!CE?#B8D9pC pBpP098J0@hXE?#B  A@! 8D9J U0 0@xPH `B !PB0(@P H!0 0p`{$!H !x@0#pB (!`8 CB(EPH!0#0(%@b0!pCxUP!pB 0xUPL!p 0Cx$pBܑ @D!8B pBx8@ 8B 8(uCPpBO 0!`#wp08B0CTP!B8F!TPL!B(U@ 8@!BP`H@'H()`B$B8@!C p@pP09BpF 080r@pCX8;C FxSP !8FBxSPL!SPL!0 B w$DBp 09C8F!X L!$IHx"!$I !DB 8 8 gPL!(U@ xCPL!hgP L!$I p!8 #PL!(U@ (RPL!HXA3~F `!bCPX!p sA H$Bx!$I8!$I(!H 0N8B HJ0 < #JhiP!BX! B(ePhD!BP X!H {$<B!H  !  x8 x # pB:\@8BPpBB@@ p,"p #hX85B! @0D9`A0D1@B0 D9@AX85B0CpF 89pCpD! H P pH@80(`xh X!  p. p #PpBB@@ p,"p #HX85B0BpF 89C8D9`A0(D9PA0(D1J0TD9C0TD1@B04D9HpJ IN 89@CpD 89CdP X!hDB8XpBO ` p< p #Pa0 D9JpJB89`APH0\D9C0E9HhA!PHhD!0B8P!B Hh$HXPPHh$H؞P0H=PX!aPX!H #NhPX!8cPxBO ` x8 x #PaHLP X! I$ hD@8 #0Z9ChPXh!BQXh!BpPyX DBpHxPX!8bP`Hh{PX!`HX<PX!H`PX!H #NH P H 8B9 b0aHX@!B0 PO 8B9 b0azHX@!B0@ H p$ Bp 8908PC8XD!BU PD!OH@O p$ Bp 8908PCXD!BU PD!OHH=@B P!f Ab;PT!PC$`I$(N!  `Lj@(X8;BB`@ A?#0#@9@ChFB8 `Lj@X8;C F(HP !`FB(HPT!HP !B PGP`NB`H0J pX 0 pP hD! <(xJh|X89B`%J8H9CX T!B࿂ p$ $I@!$I $!8BA$ p< 8 xD #7PT!XP T!H࿂ p$ $I@!$I $!8BA$ p< 8 xD # ! @B@FP H!$I$p$ AIB$ $DB <0# B`Ds!D Bp$`<,w0D0 $C @x$0 "!p<# (@p 0 P B8YnX pB0 8,p(8PH!U (@xH #xKX @B@H Bܑ$p s bBx!H p<0 088PCp  0880CXH!p$p c  0B!PB#d @0pp CxHX:PH!U  Bܑ$p s bBx!H p<0 088PCp  0880CXH!p$p c  0B!PB#g @0pp C8H;PH!U  %  Iē(!0b@ ! 0 0B!`8s!zX J!I !`BXzXJ!`B$iXJ!pB0!xlX p$B@8D@Hp$ A$b`U  (! 8!kXF! # 3~F4!ba @!xtX89B(Q$`00CU `@!(tXF!U `@!) pH p@$@B@(!I !`B{XpT@!B@!PB4 8 B!Bp"BCB!B`c D@!9B8Bp @ـB d@!pYB8 рB`p"B y@!rB8J U  8N  8R`  82h  86p  8:x  8>P  8*X  8.H  8&@  8 8B(%0@H0! bB8@!B{X8 0`C pD9@09J@!(U@ rXpB@p@'pJH @B@ (@!XH!PBX 8 0B0@! @'!  b(@!` HpX0 0pCqXpB0$pB@p@'@ChpX0 0BJ@!U  @B@(@!`BX 8 0B0@! @'`@?#O P!@0B!H @8Bd \ 0Bx1B` $!`HBb@1B1B1B0B &xD #pCXDp @&pd # p(T# p, p9 r 8@H p<,pH # p$x8@ x&pH # x. pX#p` `<(8&\ <&8@8.IB1B(=1~F Q$@bpF 090C(U@ `@!xX L!H p!p80 jX!B@@!XL!p@ @C@!H ̓ !pB8uX8B!BXpB!`B PB! !B`  B!PAB`B HB  X"@ @B `$J}) 0 h&P p*Z})@|SxB})|S,D |S .0` |SH9R @0BaBz@b PAT pB<ʠ@a9T(В@5q9(XL!pBbXL!p@ C x$<Bp 09C xw$<B8xpX L!Hx!H 8F<  p. p< #XL!(U@ `@!8$xPL!`H  I@ !U pB 8!HX H!H p!P80 gXH! B x$<Bp 09C xw$<B(oXH!PB ̓0!X H!p@ a0 pw #  x< p,p< #8HPH!`HH !<BfX!Bh^X@!BH !<BfX!B]X@!B2~F xw$b` p!@80 eX !BaXp!B@Bp 09p)PB x8@ < 8(pp@<Bpp<0# p!8 09p)PB x8@ < 8(pp@@<Bpp<0# p!8 09p)PB x8@ < 8(pp @<Bpp<0# p!8 09p)PB x8@ < 8(pp@<Bpp<0#U `!H ()B`(pw$`B ! 090C@!(U@ 8D(cXL!p B ̓ !BhXL!p@ a @B! p`$K !pBhmX0@!O 0 p@p0 "x8@8@CXD@"XbX8!BX8 0Bp$ 8FJ8DaX!BP H B(pw$0Bxb  !  8! HXaXF!@ B ̓(!X89 B @ #  @H H !PB@ 0B! AI !<Bp 09C p"<0 8<8Cp P Hp(%$=PH!U PH!U p$PHppJH0H !8=PD!U 0RH !<PD!U xw$AIp!@Hp 880C p`8s@$Hp Hp p`8s@$HpP$@H@z$`H!H I #H (pD #@&  H (!0b !  p. p #PpD`#sF$ J! BB<0d9p"ssP98 s8D@P@H4B9s0CH(B9!@xAhP J!  p. p #جPpD`#sF$ J!`"s @p9p"ssP98 s8DA@ @A JePJ!H@! U0 @$ U0 % ` Hpw$PBH b !P0 @BWX(BBxcXH!P HX!B(TPHB9O 8B9 C @A?#BU 3|F!ba(@!x]Xp!p# w @!CxKx8 Ixp@$ @$C888QC8881C888`C888@@C888 C8880CU `@! @!P HX`X89B@$HPzH !@B p 89BH_X09BCp@ BpP89B pHpP89 @H!B@?# 04PC xxP89@C@?# 04Jx<(r@! C@@!U H53~F8$Hax@!B  8(ppw$C (!< 8(p@0|5?C1L!<C`JWX@!B p 8B8 8B ppP89 CpHpP8 qH9pJ`JHWXx@!B   p. @pP@8 @ C pFpPX. `J`BVX@!B p 8Bx!p@0# ppP89Jpz$@~Fp 09H Bp 09B0@8 C pH`rH8(p0C pBpP09 B p@$80 XB!PT!0B 80 09PC @!@0 8]X!B`]XX B@Y X V!`XYH)X!0B P X! @`PXp$B P 8DBPXT!B(X!B`RPT!(# @!@0 xRPT!`C@L!HU `@! Xy$`J`BSXT!HH^XpB!r@ p89@09J8XXpBArDXHxw$B0 p!80 HSXT!Hx @BhT!HXB!؛Px@!B`@ hX!BpH(%`B 8@!xZX8 !B&XL!B@ !H p@8 8NHNX0D9B 0p@(U@ p 8DpQ"`B8!$I  x!B!"p (!0 09H JBX!`C0L9 DaB@C0H0 C0L9 DaJ0P9,`C pVp<@ ppP 8pq"\C0$K`B pVp<@ ppP 88P C@"@KD!0H pV0  p8 8 08(@NX89KD!BpJ 8N. @C8F9 8 N. K8!N. P9pHp@x$"pX!pJd 8ƸH#PAz"s0!B J0 ,s p`pPp@z$ 0F9 B0Bp 09@B0N9Cp z$ BMX89Cpz$ B 0b9PBLX890C pJ 9 @ 8Bpz$ B 0b9BHLX89C 0@9B@`r B VJ0BXP89B`@ J0K , L9@ R 8  (KX89KpTB@0%K x 80 h090JH,Hp z$ BJX09J @P!`r@`r BpJ`r@pUp 8J8 #Bh  x 80 h89B%H81H @!`bp 09Cp$`s@0Bp 88F8CH@!B.P!BHD!0CHIPP!@B!8U` x B` H@!80 h89B @xy$C@B!< #p0 p z$80 09Jx B@(`xh!B@H xy$< 88%pH853~F@ p@B890C D!Y p8@ 80 89J0D9Bp$@BB@ X!$B@PY! B`EXP!0 QXH!BhXH!BP@EXpHB@89BH F! H@, HXpHB`@H$ 89pCx@ ,@ @!q$@Yx8BI 0Dx@0#p 89J,I 0 a08R80CFPP!Fp C@F!8U` `@! !@!0B@H@hOXH!BXH!BP@XCXpHB@89`K H!J$@ p B!0 PHJX89BcC D! Y p@ @8Bp 89K @ @B HB80 IX89BcJHBxDPp@!B8BPH!F!BPBHIX89B@JHBDPP!0# Hu.2~F@8B9@b @ <0 8@`$I"40Cx |$` C!<B!xEX85B@B pdp8 sp@0#pbHEd p`!`8s8BPY09X ,PB8!2B`I H!P!0 `8Yp8F `B p`pP@8 @pC pPp@ ppP ! 0H9C pRp@ p`pPP8 PC pRp@ ppP!8F90CCXl!p j0Bp\ 89C0H8C 8N!0 0, 0F!8 08(p@8F8J(MXpB1r@ ph9@09pJH;XpBArD  0H9pJ8N0 B80B0 J0@9 8DF90C pDpP09pC@!PBB@p,8X l!@0# x0$<B p`8sp X,@@80 Bp$pBY!$80 =Xl!pBXIX00,`@Xl!0C 9X `CD!BH(EX89B`B@@D!,  9X p0 DX89CPT! 8T0J0@0H8 K8N!pLP,0 p8J 8 8(p !K pPp@ ppP8908K8@Xl!p j`JpV1B`8 N!0Bb890Jpr0  Lp0#XP89KLBv+Pp p c 8?#HhIXpB1r@ ph9@090J7XpBQrD0H P0@F!FX!B@al!p2B\@0l9@8 B Dp qD D0C t pC. 08Bp@88J8pC0H8`C pC.  p@8B8@C@F!!8lB9 D*0C 8B9psD @!+ p@pP898C!<~FwDR=@DPB0|1J8C9PJDHDD H@P!#pXpC. B p@8J8PC, @8H  p  09@JxXpC. B (p@8H8@C pC. S@ @HXx,  p8 8 p  09`JXpBQrDp 08H80HXpB1r@ pX9@09J8XpBArDp  !HXx,  p8 8 p  09JXpBrD@pH, A pX9@09JHXpBQrD ppXpHXx,  p8 8 p  09JXpBArDp @8J pH(% BD!@bWXL!B H p!80  !<0 89x$C p0 X89, 0x@B@B@p3~F !HH x$B !p8B!bxr   pp<@ (X #H4X0VB (\@0#`-hD4X \BHp~&Ipp !Jp 09`J ppP098@@J H!8# xV?~F00 C(J! B` Y xX(Yp8  HpF B  H(F pB0tXXpT B 0<0 !`B xVr @00P C(J!!@@D xX(Y p8 8 # H!0,H8jB@b 0d0B@Y8Q `4:@8Z[XpjB@00JpF p  J!8# xV?~F00CxX,xD x$ 8B  89<B Bp 09 B ppP09 Bp| 090Bpr 89B $ #  ! 00pC80B @a{!c,0$C{$0I 0^pB@ ( J1  08B0CYxb!, "D(N8"@ppX(> 0  xD8@pBpX 0B0 pD 8B< @:  0  pH 8B p< H& PpB BpB8B9I@B)rX "r! 9 @*rp< #B! 8B0PC pD`pa^CYpF0 CY HQ0!qDppX(> 0  xD8@pBpX 0B0 pD 8B< @:  0  pH 8B p< H& HPpB BpJpP 88J xn 880`JpR 80@J pTp<@9H  0@9J(@!CP!H0B0,PC x$;~FpUpF @ B` Y<H"!0H p< P0 8V`8,hD,X0VB (\@0#`-hDh,X \BpH p< P0 8V`8,hD(,X0VB (\@0#`-hD+X \BH(@!`THh\X89B`@@c@C xDcI @  090C(B!H^X!PB@@@{$BpF 00C0B!P,Y J!P<@MX!, 0 $8=@`x@ #nH$P!` rJ `{$@B p`8rpNPȃ< H(!X!(P!0 0HA$H p< P0 8V`8,hD)X XBH^Xx)  p8 8 `8(PJYXpBarDp0H p< P0 8V`8,hD()X XBH(b`)6&R 0 X1VR`4)0"E`-(X0DB (^@0#`-(X ^B@PHxP$H a (!P<B ! 1# 8j`0 p-8QXh!BH(b`)6&R 0 X1VR`4)0"G`-'X0FB (^@0#`-'X ^B@H(@!hZX0!BP!H(@!`BhPpG?#B0C ppP849KFP!H p< P0 8V`8,hD&X XBPH@!$H 0 xn b{   p`Ds" @,`x !?#D"@Rː(!p8&@0p)xp)x p8" t|R9  PB xn @  p a!p c09 B 8FB 8BYpx8# By  rTP `z8@"x,qrp?x8#p| 09PBpr 890BpP 88B8pCpP BIY b  ^BpX xD #(F HB)"rn<()q P a 8a{d  rD p280 0 @C$ rn @h  0^P@8 @h, pTpp a Dp #&P ! #$ xw$<B(UXp~Bb 0  z`8sp^0  Vp0#0D^x0#HX #LV #0B p`8sL B pnp #¿ U `!0, pR@bjP!,@HB`pCpd Br H!Y0,0<$4<Bp 8 J0f10KpT B0 !p@ X0 (Y p8 p<@= #8@9KpT B00JpV B@ p?#`(9axX(J!J (XP NBHu.2~F a{$a&IJ!`f` x`p  8@Ipq:9 @ p !8 88N8` Cx!`BDXj!p jB8!B @@!B Y p !8 890B@B ^80#0p@ Ba @!pp ` XB!`C pPpP09@CXP89 CL!pB !P0!B B! H@P8!,@X j!9@@zL!B A!pB XB!pp 0Jp@@@!,@8 1PC p@pP098B0C pBpP088`C`@ BxX!pC pPpP89PCHR!<B0C pRpP89JhB 0B"xZ!pC pTpP89PCF!<B 0C pFpP89J8T8 0PG8C@d@P! B88 0K pPpP098BK pTpP088JPHp$@Xj!p j@B x |$<Bp 89p C S?#p~F:@H 4 019@C xH <(pP0<8C0\9 RqBCD9p 0 za8 p` 08`CPj!@B p$8  0 p8p # 0A$p0 0n9 X!0BFXX!Bxx$A&IB p!8 89@BBIpBp 88V0IPB xbp` a8:0Bp 080 CpT pBPpP B`rH>Xj!p j@B |$@Bp 89 C0V!xx$pBIB p!8 89BpN 08^8C=Xj!p jPB x |$<B pp8 spNp @0Z90B pNp @ 0 B8T =Xj!p j@B |$@Bp 89 C@N!p{$p c C (!8 00 B 88dQ£|$&I p !8 09@ @ C88L0<B0Bp 89 B$H p !8 09 0J9` B HQ09<B Bp 090Cpb 010 CT!B 0'Ppbpr @ 8N1B0`,28bKL!Pj!pBN!B4PpbB@8b@d I?#p~Fzp!@h:019`K xH <(pP0<8J H $@B p`8sp !Jp 89~FpJ888`J9Xj!p j B x |$<B,p 89, B xp<"@ 8n10C#Pj! P!0#(9X!BdB!B6Xp!B@05 Ha  B89 Cxw$pHp!X8Xp`H P^! #H p`{$80 8 9pC p` !8  8`@Á@9 #  8 9J@$0H(! B 0!8X D!BxP{$ p8B80H(! B 0!X D!BxP{$ p;~F8 ) B (#p0@80b8B!CxX!BXJ!`B 8@!BXJ!pB0$BXJ!XJ!@! U0 H  !0 89@B4P@!B Xp@BpJ@!U b! C8@9@C@!U KA?#XX09B !J3P@!B  0B hPF!Uܑp{$I !90#@ "@ x8  < H !I x@p< r@!C "X p< 8 8(@p ! 8"PCPx@B  489 @!JU 0H !bhXD! B@@ $H 4U &8  x 0#8"<$@L0#H@4 !I p@  !`8C$0# "@@B  !`@Cpw$U  !0  8@ 翟x8  < P F!0# $I $D #0 9@@BpJx@ !@@Bx80  xD #8@H0#PF!Uܑ !0  8@ 翟x8  <  ! `H@ 4xP$I0b pDp< p!ɜB8p@,#4`BpB 89B pd$p< #X J!@0#xD0 @xX x!p@@xX0  PHwXL!p j@C x |$<Bp 890C8@!BX H8@!BXH8@!BXHPA1~F X!bCvXV!` r@C x |$<Bp 89Bp@!P HpA?# x$0*ժ)(Y0<4 Cp$ 88@0,B!JX!BPChA!, * pH!@lXV!`aJ8@90C 8F0p(1pBr 08 `t ppX p 8#XV!p sJ`D!sPV!B 8PU `@!x0$0ID 8 (! BDc`A!B p D`8cpp= # xD #@!,p~Fp@0$CH$5`B+98p@sppC$!E@b2EH, p< pP @ >~F< xJ p" 8 8(r8x9 B $!p: s8q H 8L0 #0N9C00C 8Ip!@! U0 !$HB 8D`0 0L9BX0!B(X0!B8@XJ!`H09 8L!J$!pBX @  p@?#p@0$5B $!@ q:EH,8(p@p p>~Fu8 pJPH@B!PJ!`H<(@r$q"HHp$!B 8$p #P89BJ0$X p! # (@! U0 p$!BD 8$p #(P HH9PB`P!Bx P89@ B P@!pCp 89@C (J!(Y p8H 80 89J 8(@?#p Q?#p #/ 8@9 /HJ0`(a@B pB sP B0@0B0!0J1 PC,@ p8H 80 PT!`aJ`H!hPT!B_@!"pC@!,@ p8H 80 X B J`F! B !`YX0!BK0,YH 2@hFXT!0 XpD!!@ P88B0 8Y@09@,ar`aJ Hi.`f ! &rp'0b C8Dp@BP!`B x|$~H?$8( 89C 8C H!P@ pJpPH90BpC0H9 0$Hǹa Bq,`C (N @8(` 0H9"J@V!@p^B0 ZpP08H8KXX89B0`Cp,0P0 0B0\G9 B 8LP #pT!@2 @`CH!0, Y PT!0$@YX!,  H!@ FXXxF,: j!p$@ 80# p pP89JpH`)X!pB`Y XX!B HH!p0 BXpJ!B@H!C ppP09 08C89 C89PC89 C pN 8 8(@rB pN p0  p`pP0F9B@BX89B0HF!0YxN @~H ?$< 8(p`K ppP8p9B@8R9C0L! 0L!0Y pN 8B ppP89K ppP8p9CpN `8s ppP0r9`JpN `s@B ppP88R8 H!@KpN p s0J p`pPF9BJJX89BKdBJX89#HF!H p!8 8(pJ`H89C0 L!@H0L!0H0H9 0Hǹ%H0F9JH0p9JH pJ!8 8(r0L!`H098B0JHX89BpJH O@ H  % 3~F0@!pBa!0bXXp@! B ( xp? wxX8F9 @!PC 01p $@pC, p8B `80 Pp@!Bx 00J !Y x8 x@p 89pCpA!`< @@aH@!vPP! B@ `F!BvP P!Hp 89`Bp@ 09@C8p9CpD 89Cp 090BpD 89@C@!0UP `N!p@ 09K8p9C@$H p@!8 89 J0H pD!8 09J89J p D!8 8%H p@!8 89`JH!`rCp@ B!8(pT,PC  < 8(u(!CX (!I@X 8B p pL# ppP89B@x$ T,  < 8(u(!CX (!I@X 8B p pL# ppP890C p"pP89`JT,r(1`0Bf8!@b@!XXp|! B 8 HF!;XD@@ !L!`8 @ p@!8B8LXXM?#BHL!BVrPp  BGP!PCp!B`7 p,"`8 @ @A!@0#8rPxB`B`N!PB  !`<rC pH"@pX,`C 8$ <  8pQ TB1T,L$ T, D !G~F p pP #p 89B@xL$ X, 8$ <  8pQ TB1T,L$ T, D !G~F p pP #p 89@C0Cp" 89PJxBX,`7@F!BB@ p8 8 #VXXp@ B(U@ `L!b`XF! 85U0CHU H 3|F!b0A!Xp!p@ a @'@AxKx0 p$`p<q@OU `@!`Q"0Bg!Bx!f0@9e`0C p@pP89BB!X8 0C`?# H@aDHP89Bp D Hc0@80#9C8P9@C0P9,C! p?#``CpUp F! F) x Usage: %s [GNU long option] [option] ... %s [GNU long option] [option] script-file ... GNU long options: --%s Shell options: -irsD or -c command or -O shopt_option (invocation only) -%s or -o option GNU bash, version %s-(%s) ia64-mandrake-linux-gnuType `%s -c "help set"' for more information about shell options. Type `%s -c help' for more information about shell builtin commands. Use the `bashbug' command to report bugs. !XPH@80(  xp `XPH@80(Hreader_looptimed out waiting for input: auto-logoutPWDeterm/%s PROMPT_COMMANDTMOUTsyntax error"$@"$@parser stack overflow./parse.ystdinreadline stdinifthenelseelifficaseesacforselectwhileuntildodone{![[]]-p&&||>><<<&>&;;<<-<<<&>>|EOF<-|&newline_unexpected EOF while looking for matching `%c'unexpected EOF while looking for `]]'syntax error in conditional expression: unexpected token `%s'syntax error in conditional expression-nunexpected token `%c' in conditional commandunexpected token `%s' in conditional commandunexpected token %d in conditional commandunexpected token `%s', expected `)'unexpected argument `%s' to conditional binary operatorunexpected token `%s', conditional binary operator expectedexpected `)'unexpected argument `%s' to conditional unary operatorunexpected argument to conditional binary operatorconditional binary operator expectedunexpected argument to conditional unary operator; %s.%dtty%a %b %d%H:%M:%S%I:%M:%S%I:%M %p%H:%M ; ;|&syntax error: unexpected end of filesyntax error near unexpected token `%s'syntax error near `%s'Use "%s" to leave the shell. exitunexpected EOF while looking for matching `)',*451+0/2.3  !"#$%&'()-6777788899999999999999999999999999999:::;;<<====>>>>>>>>>>>????????@@@@AAAAAABBBCCCDDEFFFGHIJJJKKLLLLMMNNOPPQQQRRRRRRSSTTTUUVVVWWWWWXXXXXYYZZ  {{{&'[{{(+-.1;5207689:}k{{{{ !#$ &,)/vw{{~{{|jlu{{yxz{{{{{\{ "% ZV*{{{{{{{{{{{TS{{Wnom`{{{{FG{{{{34UQYpqrstPfaNh<{=H{IRX{{{{gO{>?{{DEJK]{ibc{{{{{_deBC^@ALM !c"#$%&'()*+,-.56pqf{7/r23J JJ+J*J2GJ"LRYbJJe|JJJJJJJJJJJJJJJ)HJuJJ>J}_uJ#KJJJJJJJJJJJJJJJJJJJJJJJJiiJuJJJJJzJJJJJJJ{JJ&JuJJJJJJJJJJJJJJJJJJ>>00uJJJJJJJJIJJJJ&JJiiuJJJ>>>>>J JJJJJJJJJJ>JJ&JJJJaaaJJJJJJJpJJJJJJJJJJJJJJJsJJJJJJ>>>JJJ>JJJJJJJ>!JJ#JJJJJJJvJJJJJJJ`JJJJJ4JJcZJKJjJF<=10b@PQ84;]^?su}9:R>m oTUoBooCNoghoVdeOSWghX11vYijo&'Z[ wxyzb\11oo_ knooto|~11wxy` !wxy  "# (  $ %)*+,a A o   l  o DEFGHIJKLM$ ., 5. 89;5>1 3,,4,Ac4,42,ghk2,11,-2t4{|nijjlv*+z,~21+,-2,,2.2,,+,22+24+,-5 !"#$&'()3/0553 !"#$&'()%/0 3  3+,-%33 3*+,33 !"#$3&'()",-/024   !"#$&'(),/024  !"#$&'()/024  !"#$&'()/024  !"#$&'()/024  !"#$&'(),/024  !"#$&'()/024 !"#$&()/0  !"#$&'(),-/02479:<=>?@ABCEFGHIVWXYZ,OPUPPYZ4 !"#$&()/011PP:9;,-S*+.Y,QRXU+U+,-2T+U4UY511359UUWWUYP*+,U2PPUU2PP5>DUWW*+YJUUUUUKLMU2P8TP322OU8OU;DPPRRRRR %LU 4NPPTU3PPOORT3D*+,% N.53U233UPUUU5PU2PP2JPUPP3OOP338g0gx@h ؃Hh Ȁ(P`~}p}(}||P||{x{0{zzz`zyyHy yx@xxwww8wwvvvpvHv vuupphonn@nmmhm mlljpjhkirr8rqq0qqPpxs0srrsssi8gf8dfXf feed@egg8gcgc(hcgdXddccccxcpchc`cXcb8baa@a``x`P`__8_^^`^8^^7P-7`68-0-(- -----,,,4444444x4,,,,,x,p,h,22P,H, 78,0,(,9,,,,+++++++P2+`.,+++606p+h+`+/P+H+1/0+(+8+.+0* 0***`/.P1-`-+ ==&%s-%d<&%s-%d>&%d-%d<&%d-%d>&%s%d<&%s>|%s<>%s>&%s%d>&-<<%s%s %d>&%d>>%s<%s>%s%d<&%dfunction %s () { } () %ucprintf: bad `%%' argument (%c)HآPp8Hp@x0X X0dispose_commanddispose_cmd.c0H0( 0(execute_cmd.cexecute-command/dev/nullcannot redirect standard input from /dev/null: %sloop_redirectionsexecute_commandpipe-file-descriptorspipe errorexecute_connection((%*d%s%sLINESCOLUMNSREPLYPS3#? execute_cond_nodesimple-commandbgfgauto_resumeexactsubstringbuiltin_enveval_builtinreturn_temp_envfunction_callingexecute-shell-functionsaved redirectssaved_redirects%s: command not found%s: restricted: cannot specify `/' in command names%s: %s: bad interpreter%s: readonly functioncannot duplicate fd 1 to fd 2cannot duplicate fd %d to fd 0cannot duplicate fd %d to fd 1xxph`Xx0P() {variables.cerror importing function definition for `%s'/usr/local/bin:/bin:/usr/bindumb+ IFS MAILCHECK60060OPTINDOPTERRBASHBASH_VERSION~/.sh_history~/.bash_historyHISTFILEHISTSIZE500IGNOREEOFHISTCONTROLHISTIGNOREignoreeofHOSTTYPEia64OSTYPElinux-gnuMACHTYPEHOSTNAMESHLVLshell level (%d) too high, resetting to 1shell-initPPIDUIDEUIDBASH_VERSINFO%s=SECONDSDIRSTACKGROUPSFUNCNAMERANDOMLINENOHISTCMDmake_local_variable: no function context at current scope found%s%s=%s all_local_variables: no function context at current scope found) {_=pop_var_context: head of shell_variables not a function contextpop_var_context: no global_variables contextpop_scope: head of shell_variables not a temporary environment scopeGLOBIGNOREHISTFILESIZEHOSTFILELANGLC_ALLLC_COLLATELC_CTYPELC_MESSAGESLC_NUMERICMAILMAILPATHTERMCAPTERMINFOTEXTDOMAINTEXTDOMAINDIRTZhistcharsignorePIPESTATUScopy_cmd.cPNHN@N8NM(NPNHNM8NNMMMMNNMMX[[\[h[0[8]]\\X\ \[[bash-maintainers@gnu.org%s: Stopping myself...last command: %s (null)%s: warning: %s: %s: line %d: %s: line %d: unknown command errorbad command typebad connectorbad jump%s: %s: %d%s: bad array subscript%s: unbound variable%s: readonly variable: expression recursion level exceededexpr.crecursion stack underflowsyntax error in expressionattempted assignment to non-variablebug: bad expassign tokendivision by 0`:' expected for conditional expressionexpression expectedexponent less than 0identifier expected after pre-increment or pre-decrementsyntax error: operand expectedmissing `)'*/%+-&^|bad array subscript%s%s%s: %s (error token is "%s")bad numberillegal arithmetic basevalue too great for base`XPH@80( بШȨxph`XPHШ0H اflags.c |%5ld (wd: %s)| (core dumped) &job-working-directoryjobs.cdeleting stopped job %d with process group %ld[%d] %ld describe_pid: %ld: no such pidDoneStoppedRunningUnknown statusDone(%d)Exit %dStopped(%s)%*s[%d]%c %ld forkchild setpgid (%ld to %ld)[%ld: %d] tcsetattrwait: pid %ld is not a child of this shellwait_for: No record of process %ldwait_for_job: job %d is stopped%s: job has terminated (wd: %s)%s: bg background job?SIGCHLD trap (core dumped)(wd now: %s) notify_of_job_statusno job control in this shellinitialize_job_control: getpgrp failedinitialize_job_control: line disciplineinitialize_job_control: setpgidsubst.c$($[[`bad substitution: no `%s' in %sbad substitution: no ending `}' in %s%s%s=(%s) %s: cannot assign list to array membercannot duplicate named pipe %s as fd %dcannot make pipe for process substitutioncannot make child for process substitutionprocess substitutioncannot make pipe for command substitutioncannot make child for command substitutioncommand_substitute: cannot duplicate pipe as fd 1command substitution%s: parameter null or not set%s: substring expression < 0#%:-=?+/}%s: bad substitution??%:=+/$%s: cannot assign in this way<(>(h`XPH@80@ph`XPH@80( .,--,,,,,,,,P-x,p,h,`,X,P,H,@,8,0,(, ,,,,,++pgxpogggngpogghnggmmmmmmmmmm0g(g gggmlffffffffffffffffxfpfhf`fXfPfHf@f8f0fhi fffffeeeeeeeeeeeeeeeexepehe`eXePeHe@e8e0eHghashcmd.chashlib.cmailcheck.cYou have mail in $_You have new mail in $_The mail in %s has been read EXITSIGHUPSIGINTSIGQUITSIGILLSIGTRAPSIGABRTSIGBUSSIGFPESIGKILLSIGUSR1SIGSEGVSIGUSR2SIGPIPESIGALRMSIGTERMSIGJUNK(16)SIGCHLDSIGSTOPSIGTSTPSIGTTINSIGTTOUSIGURGSIGXCPUSIGXFSZSIGVTALRMSIGPROFSIGWINCHSIGIOSIGPWRSIGSYSSIGJUNK(32)SIGJUNK(33)SIGJUNK(34)SIGRTMINSIGRTMIN+1SIGRTMIN+2SIGRTMIN+3SIGRTMIN+4SIGRTMIN+5SIGRTMIN+6SIGRTMIN+7SIGRTMIN+8SIGRTMIN+9SIGRTMIN+10SIGRTMIN+11SIGRTMIN+12SIGRTMIN+13SIGRTMIN+14SIGRTMAX-14SIGRTMAX-13SIGRTMAX-12SIGRTMAX-11SIGRTMAX-10SIGRTMAX-9SIGRTMAX-8SIGRTMAX-7SIGRTMAX-6SIGRTMAX-5SIGRTMAX-4SIGRTMAX-3SIGRTMAX-2SIGRTMAX-1SIGRTMAXDEBUGERRbad signal numberunrecognized signal numberSIGtrap.crun_pending_traps: bad value in trap_list[%d]: %prun_pending_traps: signal handler is SIG_DFL, resending %d (%s) to myselftrap_handler: bad signal %dexit trapdebug traperror trapinterrupt trapinput.ccheck_bash_input: buffer already exists for new fd %dcannot allocate new file descriptor for bash input from fd %dunwind_prot.cpathexp.c.////................x.p.h.`.X.P.H.@.8. .- .....----------------x-p-h-`-X-@-8-0-argument expected%s: integer expression expected/dev/fd/`)' expected`)' expected, found %s%s: unary operator expected%s: binary operator expectedtoo many argumentsmissing `]'ZYYhY0YXPleeeehek`keeejxepehe`eXePeHe@e8e0e(e eepi(jixiPihphgddgddHg gfdf@fe0ehdedPdxdpnXnPnHn@nHn0n8n0nnnnnmmmmmmmmmmmmmmmmmmxmpmhmPmHmPm8m0m8m0m(mmmmmmlllll utptHtPs2.05brelease@(#)Bash version 2.05b.0(1) release GNU%s.%d(%d)-%s%s.%d(%d)GNU bash, version %s (%s) Copyright (C) 2002 Free Software Foundation, Inc.alias.c ;|&( ;|&()array.carrayfunc.carray assign%s: cannot assign to non-numeric index%s[%s: bad array subscript[%s]: bad array subscript%s=%s ()'()'braces.cbracecomp.c;&()|<>%s: cannot create: %sbashhist.c%s%s%s "'@><=;|&(: "'><=;|&(:comment-begin#$shell-expand-lineBashhistory-expand-linemagic-spacealias-expand-linehistory-and-alias-expand-lineinsert-last-argumentoperate-and-get-nextdisplay-shell-versionedit-and-execute-commandcomplete-into-bracescomplete-filenamepossible-filename-completionscomplete-usernamepossible-username-completionscomplete-hostnamepossible-hostname-completionscomplete-variablepossible-variable-completionscomplete-commandpossible-command-completionsglob-complete-wordglob-expand-wordglob-list-expansionsdynamic-complete-history'" \"'@<>=;|&()#$`?*[!:{bashline.chostname_completion_file/etc/hosts$include %s %dC-xC-evfc -e ${VISUAL:-${EDITOR:-vi}}fc -e ${VISUAL:-${EDITOR:-emacs}};|&{(`()<>;&| FIGNOREsymlink-hook "'bash_execute_unix_commandbash_execute_unix_command: cannot find keymap for command%s: first non-whitespace character is not `"'%s: no closing `%c'%s: missing colon separatorstringlib.clocale.cPOSIX"" #: %s:%d msgid %s%s msgstr "" findcmd.credir.c%s: ambiguous redirectfile descriptor out of range%s: restricted: cannot redirect output%s: cannot overwrite existing filecannot create temp file for here document: %ssh-thd/dev/tcp/*/*/dev/udp/*/*redirection error: cannot duplicate fdxphPH@80(0( H @ XP( XPHpcomplete.cCOMP_WORDSCOMP_LINECOMP_POINTCOMP_CWORDCOMPREPLYcompletion: function `%s' not foundpcomplib.cprogcomp_insert: %s: NULL COMPSPECB H ## xmalloc: cannot allocate %lu bytes (%lu bytes allocated)xrealloc: cannot reallocate %lu bytes (%lu bytes allocated)xmalloc: %s:%d: cannot allocate %lu bytes (%lu bytes allocated)xrealloc: %s:%d: cannot reallocate %lu bytes (%lu bytes allocated)The flags are: -a to make NAMEs arrays (if supported) -f to select from among function names only -F to display function names without definitions -i to make NAMEs have the `integer' attribute -r to make NAMEs readonly -t to make NAMEs have the `trace' attribute -x to make NAMEs exportVariables with the integer attribute have arithmetic evaluation (see`let') done when the variable is assigned to.When displaying values of variables, -f displays a function's nameand definition. The -F option restricts the display to functionname only.Using `+' instead of `-' turns off the given attribute instead. Whenused in a function, makes NAMEs local, as with the `local' command.aliasalias [-p] [name[=value] ... ]unaliasunalias [-a] [name ...]bindbind [-lpvsPVS] [-m keymap] [-f filename] [-q name] [-u name] [-r keyseq] [-x keyseq:shell-command] [keyseq:readline-function or readline-command]breakbreak [n]continuecontinue [n]builtin [shell-builtin [arg ...]]cdcd [-L|-P] [dir]pwdpwd [-PL]truecommand [-pVv] command [arg ...]declaredeclare [-afFirtx] [-p] name[=value] ...typesettypeset [-afFirtx] [-p] name[=value] ...locallocal name[=value] ...echoecho [-neE] [arg ...]enableenable [-pnds] [-a] [-f filename] [name ...]evaleval [arg ...]getoptsgetopts optstring name [arg]execexec [-cl] [-a name] file [redirection ...]exit [n]fcfc [-e ename] [-nlr] [first] [last] or fc -s [pat=rep] [cmd]fg [job_spec]bg [job_spec]hashhash [-lr] [-p pathname] [-dt] [name ...]help [-s] [pattern ...]history [-c] [-d offset] [n] or history -awrn [filename] or history -ps arg [arg...]jobsjobs [-lnprs] [jobspec ...] or jobs -x command [args]disowndisown [-h] [-ar] [jobspec ...]killkill [-s sigspec | -n signum | -sigspec] [pid | job]... or kill -l [sigspec]letlet arg [arg ...]readread [-ers] [-u fd] [-t timeout] [-p prompt] [-a array] [-n nchars] [-d delim] [name ...]returnreturn [n]setset [--abefhkmnptuvxBCHP] [-o option] [arg ...]unsetunset [-f] [-v] [name ...]exportexport [-nf] [name[=value] ...] or export -preadonlyreadonly [-anf] [name[=value] ...] or readonly -pshiftshift [n]sourcesource filename. filenamesuspendsuspend [-f]testtest [expr][ arg... ]timestrap [arg] [signal_spec ...] or trap -ltypetype [-afptP] name [name ...]ulimitulimit [-SHacdflmnpstuv] [limit]umaskumask [-p] [-S] [mode]waitwait [n]for NAME [in WORDS ... ;] do COMMANDS; donefor ((for (( exp1; exp2; exp3 )); do COMMANDS; doneselect NAME [in WORDS ... ;] do COMMANDS; donetimetime [-p] PIPELINEcase WORD in [PATTERN [| PATTERN]...) COMMANDS ;;]... esacif COMMANDS; then COMMANDS; [ elif COMMANDS; then COMMANDS; ]... [ else COMMANDS; ] fiwhile COMMANDS; do COMMANDS; doneuntil COMMANDS; do COMMANDS; donefunction NAME { COMMANDS ; } or NAME () { COMMANDS ; }{ ... }%%[DIGITS | WORD] [&](( ... ))(( expression ))[[ ... ]][[ expression ]]variablesvariables - Some variable names and meaningspushdpushd [dir | +N | -N] [-n]popdpopd [+N | -N] [-n]dirsdirs [-clpv] [+N] [-N]shoptshopt [-pqsu] [-o long-option] optname [optname...]printfprintf format [arguments]completecomplete [-abcdefgjksuv] [-pr] [-o option] [-A action] [-G globpat] [-W wordlist] [-P prefix] [-S suffix] [-X filterpat] [-F function] [-C command] [name ...]compgencompgen [-abcdefgjksuv] [-o option] [-A action] [-G globpat] [-W wordlist] [-P prefix] [-S suffix] [-X filterpat] [-F function] [-C command] [word]`alias' with no arguments or with the -p option prints the listof aliases in the form alias NAME=VALUE on standard output.Otherwise, an alias is defined for each NAME whose VALUE is given.A trailing space in VALUE causes the next word to be checked foralias substitution when the alias is expanded. Alias returnstrue unless a NAME is given for which no alias has been defined.Remove NAMEs from the list of defined aliases. If the -a option is given,then remove all alias definitions.Bind a key sequence to a Readline function or a macro, or seta Readline variable. The non-option argument syntax is equivalentto that found in ~/.inputrc, but must be passed as a single argument:bind '"\C-x\C-r": re-read-init-file'.bind accepts the following options: -m keymap Use `keymap' as the keymap for the duration of this command. Acceptable keymap names are emacs, emacs-standard, emacs-meta, emacs-ctlx, vi, vi-move, vi-command, and vi-insert. -l List names of functions. -P List function names and bindings. -p List functions and bindings in a form that can be reused as input. -r keyseq Remove the binding for KEYSEQ. -x keyseq:shell-command Cause SHELL-COMMAND to be executed when KEYSEQ is entered. -f filename Read key bindings from FILENAME. -q function-name Query about which keys invoke the named function. -u function-name Unbind all keys which are bound to the named function. -V List variable names and values -v List variable names and values in a form that can be reused as input. -S List key sequences that invoke macros and their values -s List key sequences that invoke macros and their values in a form that can be reused as input.Exit from within a FOR, WHILE or UNTIL loop. If N is specified,break N levels.Resume the next iteration of the enclosing FOR, WHILE or UNTIL loop.If N is specified, resume at the N-th enclosing loop.Run a shell builtin. This is useful when you wish to rename ashell builtin to be a function, but need the functionality of thebuiltin within the function itself.Change the current directory to DIR. The variable $HOME is thedefault DIR. The variable CDPATH defines the search path forthe directory containing DIR. Alternative directory names in CDPATHare separated by a colon (:). A null directory name is the same asthe current directory, i.e. `.'. If DIR begins with a slash (/),then CDPATH is not used. If the directory is not found, and theshell option `cdable_vars' is set, then try the word as a variablename. If that variable has a value, then cd to the value of thatvariable. The -P option says to use the physical directory structureinstead of following symbolic links; the -L option forces symbolic linksto be followed.Print the current working directory. With the -P option, pwd printsthe physical directory, without any symbolic links; the -L optionmakes pwd follow symbolic links.No effect; the command does nothing. A zero exit code is returned.Return a successful result.Return an unsuccessful result.Runs COMMAND with ARGS ignoring shell functions. If you have a shellfunction called `ls', and you wish to call the command `ls', you cansay "command ls". If the -p option is given, a default value is usedfor PATH that is guaranteed to find all of the standard utilities. Ifthe -V or -v option is given, a string is printed describing COMMAND.The -V option produces a more verbose description.Declare variables and/or give them attributes. If no NAMEs aregiven, then display the values of variables instead. The -p optionwill display the attributes and values of each NAME.Obsolete. See `declare'.Create a local variable called NAME, and give it VALUE. LOCALcan only be used within a function; it makes the variable NAMEhave a visible scope restricted to that function and its children.Output the ARGs. If -n is specified, the trailing newline issuppressed. If the -e option is given, interpretation of thefollowing backslash-escaped characters is turned on: \a alert (bell) \b backspace \c suppress trailing newline \E escape character \f form feed \n new line \r carriage return \t horizontal tab \v vertical tab \\ backslash \num the character whose ASCII code is NUM (octal).You can explicitly turn off the interpretation of the above characterswith the -E option.Enable and disable builtin shell commands. This allowsyou to use a disk command which has the same name as a shellbuiltin without specifying a full pathname. If -n is used, theNAMEs become disabled; otherwise NAMEs are enabled. For example,to use the `test' found in $PATH instead of the shell builtinversion, type `enable -n test'. On systems supporting dynamicloading, the -f option may be used to load new builtins from theshared object FILENAME. The -d option will delete a builtinpreviously loaded with -f. If no non-option names are given, orthe -p option is supplied, a list of builtins is printed. The-a option means to print every builtin with an indication of whetheror not it is enabled. The -s option restricts the output to the POSIX.2`special' builtins. The -n option displays a list of all disabled builtins.Read ARGs as input to the shell and execute the resulting command(s).Getopts is used by shell procedures to parse positional parameters.OPTSTRING contains the option letters to be recognized; if a letteris followed by a colon, the option is expected to have an argument,which should be separated from it by white space.Each time it is invoked, getopts will place the next option in theshell variable $name, initializing name if it does not exist, andthe index of the next argument to be processed into the shellvariable OPTIND. OPTIND is initialized to 1 each time the shell ora shell script is invoked. When an option requires an argument,getopts places that argument into the shell variable OPTARG.getopts reports errors in one of two ways. If the first characterof OPTSTRING is a colon, getopts uses silent error reporting. Inthis mode, no error messages are printed. If an invalid option isseen, getopts places the option character found into OPTARG. If arequired argument is not found, getopts places a ':' into NAME andsets OPTARG to the option character found. If getopts is not insilent mode, and an invalid option is seen, getopts places '?' intoNAME and unsets OPTARG. If a required option is not found, a '?'is placed in NAME, OPTARG is unset, and a diagnostic message isIf the shell variable OPTERR has the value 0, getopts disables theprinting of error messages, even if the first character ofOPTSTRING is not a colon. OPTERR has the value 1 by default.Getopts normally parses the positional parameters ($0 - $9), but ifmore arguments are given, they are parsed instead.Exec FILE, replacing this shell with the specified program.If FILE is not specified, the redirections take effect in thisshell. If the first argument is `-l', then place a dash in thezeroth arg passed to FILE, as login does. If the `-c' optionis supplied, FILE is executed with a null environment. The `-a'option means to make set argv[0] of the executed process to NAME.If the file cannot be executed and the shell is not interactive,then the shell exits, unless the shell option `execfail' is set.Exit the shell with a status of N. If N is omitted, the exit statusis that of the last command executed.Logout of a login shell.fc is used to list or edit and re-execute commands from the history list.FIRST and LAST can be numbers specifying the range, or FIRST can be astring, which means the most recent command beginning with thatstring. -e ENAME selects which editor to use. Default is FCEDIT, then EDITOR, then vi. -l means list lines instead of editing. -n means no line numbers listed. -r means reverse the order of the lines (making it newest listed first).With the `fc -s [pat=rep ...] [command]' format, the command isre-executed after the substitution OLD=NEW is performed.A useful alias to use with this is r='fc -s', so that typing `r cc'runs the last command beginning with `cc' and typing `r' re-executesthe last command.Place JOB_SPEC in the foreground, and make it the current job. IfJOB_SPEC is not present, the shell's notion of the current job isused.Place JOB_SPEC in the background, as if it had been started with`&'. If JOB_SPEC is not present, the shell's notion of the currentjob is used.For each NAME, the full pathname of the command is determined andremembered. If the -p option is supplied, PATHNAME is used as thefull pathname of NAME, and no path search is performed. The -roption causes the shell to forget all remembered locations. The -doption causes the shell to forget the remembered location of each NAME.If the -t option is supplied the full pathname to which each NAMEcorresponds is printed. If multiple NAME arguments are supplied with-t, the NAME is printed before the hashed full pathname. The -l optioncauses output to be displayed in a format that may be reused as input.If no arguments are given, information about remembered commands is displayed.Display helpful information about builtin commands. If PATTERN isspecified, gives detailed help on all commands matching PATTERN,otherwise a list of the builtins is printed. The -s optionrestricts the output for each builtin command matching PATTERN toa short usage synopsis.Display the history list with line numbers. Lines listed withwith a `*' have been modified. Argument of N says to list onlythe last N lines. The `-c' option causes the history list to becleared by deleting all of the entries. The `-d' option deletesthe history entry at offset OFFSET. The `-w' option writes out thecurrent history to the history file; `-r' means to read the file andappend the contents to the history list instead. `-a' meansto append history lines from this session to the history file.Argument `-n' means to read all history lines not already readfrom the history file and append them to the history list. IfFILENAME is given, then that is used as the history file elseif $HISTFILE has a value, that is used, else ~/.bash_history.If the -s option is supplied, the non-option ARGs are appended tothe history list as a single entry. The -p option means to performhistory expansion on each ARG and display the result, without storinganything in the history list.Lists the active jobs. The -l option lists process id's in additionto the normal information; the -p option lists process id's only.If -n is given, only processes that have changed status since the lastnotification are printed. JOBSPEC restricts output to that job. The-r and -s options restrict output to running and stopped jobs only,respectively. Without options, the status of all active jobs isprinted. If -x is given, COMMAND is run after all job specificationsthat appear in ARGS have been replaced with the process ID of that job'sprocess group leader.By default, removes each JOBSPEC argument from the table of active jobs.If the -h option is given, the job is not removed from the table, but ismarked so that SIGHUP is not sent to the job if the shell receives aSIGHUP. The -a option, when JOBSPEC is not supplied, means to remove alljobs from the job table; the -r option means to remove only running jobs.Send the processes named by PID (or JOB) the signal SIGSPEC. IfSIGSPEC is not present, then SIGTERM is assumed. An argument of `-l'lists the signal names; if arguments follow `-l' they are assumed tobe signal numbers for which names should be listed. Kill is a shellbuiltin for two reasons: it allows job IDs to be used instead ofprocess IDs, and, if you have reached the limit on processes thatyou can create, you don't have to start a process to kill another one.Each ARG is an arithmetic expression to be evaluated. Evaluationis done in fixed-width integers with no check for overflow, thoughdivision by 0 is trapped and flagged as an error. The followinglist of operators is grouped into levels of equal-precedence operators.The levels are listed in order of decreasing precedence. id++, id-- variable post-increment, post-decrement ++id, --id variable pre-increment, pre-decrement -, + unary minus, plus !, ~ logical and bitwise negation ** exponentiation *, /, % multiplication, division, remainder +, - addition, subtraction <<, >> left and right bitwise shifts <=, >=, <, > comparison ==, != equality, inequality & bitwise AND ^ bitwise XOR | bitwise OR && logical AND || logical OR expr ? expr : expr conditional expression =, *=, /=, %=, +=, -=, <<=, >>=, &=, ^=, |= assignmentShell variables are allowed as operands. The name of the variableis replaced by its value (coerced to a fixed-width integer) withinan expression. The variable need not have its integer attributeturned on to be used in an expression.Operators are evaluated in order of precedence. Sub-expressions inparentheses are evaluated first and may override the precedencerules above.If the last ARG evaluates to 0, let returns 1; 0 is returnedotherwise.One line is read from the standard input, or from file descriptor FD if the-u option is supplied, and the first word is assigned to the first NAME,the second word to the second NAME, and so on, with leftover words assignedto the last NAME. Only the characters found in $IFS are recognized as worddelimiters. If no NAMEs are supplied, the line read is stored in the REPLYvariable. If the -r option is given, this signifies `raw' input, andbackslash escaping is disabled. The -d option causes read to continueuntil the first character of DELIM is read, rather than newline. If the -poption is supplied, the string PROMPT is output without a trailing newlinebefore attempting to read. If -a is supplied, the words read are assignedto sequential indices of ARRAY, starting at zero. If -e is supplied andthe shell is interactive, readline is used to obtain the line. If -n issupplied with a non-zero NCHARS argument, read returns after NCHARScharacters have been read. The -s option causes input coming from aterminal to not be echoed.The -t option causes read to time out and return failure if a complete lineof input is not read within TIMEOUT seconds. If the TMOUT variable is set,its value is the default timeout. The return code is zero, unless end-of-fileis encountered, read times out, or an invalid file descriptor is supplied asthe argument to -u.Causes a function to exit with the return value specified by N. If Nis omitted, the return status is that of the last command. -a Mark variables which are modified or created for export. -b Notify of job termination immediately. -e Exit immediately if a command exits with a non-zero status. -f Disable file name generation (globbing). -h Remember the location of commands as they are looked up. -k All assignment arguments are placed in the environment for a command, not just those that precede the command name. -m Job control is enabled. -n Read commands but do not execute them. -o option-name Set the variable corresponding to option-name: allexport same as -a braceexpand same as -B emacs use an emacs-style line editing interface errexit same as -e hashall same as -h histexpand same as -H history enable command history ignoreeof the shell will not exit upon reading EOF interactive-comments allow comments to appear in interactive commands keyword same as -k monitor same as -m noclobber same as -C noexec same as -n noglob same as -f nolog currently accepted but ignored notify same as -b nounset same as -u onecmd same as -t physical same as -P posix change the behavior of bash where the default operation differs from the 1003.2 standard to match the standard privileged same as -p verbose same as -v vi use a vi-style line editing interface xtrace same as -x -p Turned on whenever the real and effective user ids do not match. Disables processing of the $ENV file and importing of shell functions. Turning this option off causes the effective uid and gid to be set to the real uid and gid. -t Exit after reading and executing one command. -u Treat unset variables as an error when substituting. -v Print shell input lines as they are read. -x Print commands and their arguments as they are executed. -B the shell will perform brace expansion -C If set, disallow existing regular files to be overwritten by redirection of output. -H Enable ! style history substitution. This flag is on by default. -P If set, do not follow symbolic links when executing commands such as cd which change the current directory.Using + rather than - causes these flags to be turned off. Theflags can also be used upon invocation of the shell. The currentset of flags may be found in $-. The remaining n ARGs are positionalparameters and are assigned, in order, to $1, $2, .. $n. If noARGs are given, all shell variables are printed.For each NAME, remove the corresponding variable or function. Giventhe `-v', unset will only act on variables. Given the `-f' flag,unset will only act on functions. With neither flag, unset firsttries to unset a variable, and if that fails, then tries to unset afunction. Some variables cannot be unset; also see readonly.NAMEs are marked for automatic export to the environment ofsubsequently executed commands. If the -f option is given,the NAMEs refer to functions. If no NAMEs are given, or if `-p'is given, a list of all names that are exported in this shell isprinted. An argument of `-n' says to remove the export propertyfrom subsequent NAMEs. An argument of `--' disables further optionprocessing.The given NAMEs are marked readonly and the values of these NAMEs maynot be changed by subsequent assignment. If the -f option is given,then functions corresponding to the NAMEs are so marked. If noarguments are given, or if `-p' is given, a list of all readonly namesis printed. An argument of `-n' says to remove the readonly propertyfrom subsequent NAMEs. The `-a' option means to treat each NAME asan array variable. An argument of `--' disables further optionThe positional parameters from $N+1 ... are renamed to $1 ... If N isnot given, it is assumed to be 1.Read and execute commands from FILENAME and return. The pathnamesin $PATH are used to find the directory containing FILENAME.Suspend the execution of this shell until it receives a SIGCONTsignal. The `-f' if specified says not to complain about thisbeing a login shell if it is; just suspend anyway.Exits with a status of 0 (true) or 1 (false) depending onthe evaluation of EXPR. Expressions may be unary or binary. Unaryexpressions are often used to examine the status of a file. Thereare string operators as well, and numeric comparison operators.File operators: -a FILE True if file exists. -b FILE True if file is block special. -c FILE True if file is character special. -d FILE True if file is a directory. -e FILE True if file exists. -f FILE True if file exists and is a regular file. -g FILE True if file is set-group-id. -h FILE True if file is a symbolic link. -L FILE True if file is a symbolic link. -k FILE True if file has its `sticky' bit set. -p FILE True if file is a named pipe. -r FILE True if file is readable by you. -s FILE True if file exists and is not empty. -S FILE True if file is a socket. -t FD True if FD is opened on a terminal. -u FILE True if the file is set-user-id. -w FILE True if the file is writable by you. -x FILE True if the file is executable by you. -O FILE True if the file is effectively owned by you. -G FILE True if the file is effectively owned by your group. -N FILE True if the file has been modified since it was last read. FILE1 -nt FILE2 True if file1 is newer than file2 (according to modification date). FILE1 -ot FILE2 True if file1 is older than file2. FILE1 -ef FILE2 True if file1 is a hard link to file2.String operators: -z STRING True if string is empty. -n STRING STRING True if string is not empty. STRING1 = STRING2 True if the strings are equal. STRING1 != STRING2 True if the strings are not equal. STRING1 < STRING2 True if STRING1 sorts before STRING2 lexicographically. STRING1 > STRING2 True if STRING1 sorts after STRING2 lexicographically.Other operators: -o OPTION True if the shell option OPTION is enabled. ! EXPR True if expr is false. EXPR1 -a EXPR2 True if both expr1 AND expr2 are true. EXPR1 -o EXPR2 True if either expr1 OR expr2 is true. arg1 OP arg2 Arithmetic tests. OP is one of -eq, -ne, -lt, -le, -gt, or -ge.Arithmetic binary operators return true if ARG1 is equal, not-equal,less-than, less-than-or-equal, greater-than, or greater-than-or-equalthan ARG2.This is a synonym for the "test" builtin, but the lastargument must be a literal `]', to match the opening `['.Print the accumulated user and system times for processes run fromthe shell.The command ARG is to be read and executed when the shell receivessignal(s) SIGNAL_SPEC. If ARG is absent all specified signals arereset to their original values. If ARG is the null string eachSIGNAL_SPEC is ignored by the shell and by the commands it invokes.If a SIGNAL_SPEC is EXIT (0) the command ARG is executed on exit fromthe shell. If a SIGNAL_SPEC is DEBUG, ARG is executed after everycommand. If ARG is `-p' then the trap commands associated witheach SIGNAL_SPEC are displayed. If no arguments are supplied or ifonly `-p' is given, trap prints the list of commands associated witheach signal number. Each SIGNAL_SPEC is either a signal name in or a signal number. `trap -l' prints a list of signal names and theircorresponding numbers. Note that a signal can be sent to the shellwith "kill -signal $$".For each NAME, indicate how it would be interpreted if used as acommand name.If the -t option is used, `type' outputs a single word which is one of`alias', `keyword', `function', `builtin', `file' or `', if NAME is analias, shell reserved word, shell function, shell builtin, disk file,or unfound, respectively.If the -p flag is used, `type' either returns the name of the diskfile that would be executed, or nothing if `type -t NAME' would notreturn `file'.If the -a flag is used, `type' displays all of the places that containan executable named `file'. This includes aliases, builtins, andfunctions, if and only if the -p flag is not also used.The -f flag suppresses shell function lookup.The -P flag forces a PATH search for each NAME, even if it is an alias,builtin, or function, and returns the name of the disk file that wouldbe executed.Ulimit provides control over the resources available to processesstarted by the shell, on systems that allow such control. If anoption is given, it is interpreted as follows: -S use the `soft' resource limit -H use the `hard' resource limit -a all current limits are reported -c the maximum size of core files created -d the maximum size of a process's data segment -f the maximum size of files created by the shell -l the maximum size a process may lock into memory -m the maximum resident set size -n the maximum number of open file descriptors -p the pipe buffer size -s the maximum stack size -t the maximum amount of cpu time in seconds -u the maximum number of user processes -v the size of virtual memoryIf LIMIT is given, it is the new value of the specified resource;the special LIMIT values `soft', `hard', and `unlimited' stand forthe current soft limit, the current hard limit, and no limit, respectively.Otherwise, the current value of the specified resource is printed.If no option is given, then -f is assumed. Values are in 1024-byteincrements, except for -t, which is in seconds, -p, which is inincrements of 512 bytes, and -u, which is an unscaled number ofprocesses.The user file-creation mask is set to MODE. If MODE is omitted, or if`-S' is supplied, the current value of the mask is printed. The `-S'option makes the output symbolic; otherwise an octal number is output.If `-p' is supplied, and MODE is omitted, the output is in a formthat may be used as input. If MODE begins with a digit, it isinterpreted as an octal number, otherwise it is a symbolic mode stringlike that accepted by chmod(1).Wait for the specified process and report its termination status. IfN is not given, all currently active child processes are waited for,and the return code is zero. N may be a process ID or a jobspecification; if a job spec is given, all processes in the job'spipeline are waited for.The `for' loop executes a sequence of commands for each member in alist of items. If `in WORDS ...;' is not present, then `in "$@"' isassumed. For each element in WORDS, NAME is set to that element, andthe COMMANDS are executed.Equivalent to (( EXP1 )) while (( EXP2 )); do COMMANDS (( EXP3 )) doneEXP1, EXP2, and EXP3 are arithmetic expressions. If any expression isomitted, it behaves as if it evaluates to 1.The WORDS are expanded, generating a list of words. Theset of expanded words is printed on the standard error, eachpreceded by a number. If `in WORDS' is not present, `in "$@"'is assumed. The PS3 prompt is then displayed and a line readfrom the standard input. If the line consists of the numbercorresponding to one of the displayed words, then NAME is setto that word. If the line is empty, WORDS and the prompt areredisplayed. If EOF is read, the command completes. Any othervalue read causes NAME to be set to null. The line read is savedin the variable REPLY. COMMANDS are executed after each selectionuntil a break command is executed.Execute PIPELINE and print a summary of the real time, user CPU time,and system CPU time spent executing PIPELINE when it terminates.The return status is the return status of PIPELINE. The `-p' optionprints the timing summary in a slightly different format. This usesthe value of the TIMEFORMAT variable as the output format.Selectively execute COMMANDS based upon WORD matching PATTERN. The`|' is used to separate multiple patterns.The if COMMANDS are executed. If the exit status is zero, then the thenCOMMANDS are executed. Otherwise, each of the elif COMMANDS are executedin turn, and if the exit status is zero, the corresponding then COMMANDSare executed and the if command completes. Otherwise, the else COMMANDSare executed, if present. The exit status is the exit status of the lastcommand executed, or zero if no condition tested true.Expand and execute COMMANDS as long as the final command in the`while' COMMANDS has an exit status of zero.`until' COMMANDS has an exit status which is not zero.Create a simple command invoked by NAME which runs COMMANDS.Arguments on the command line along with NAME are passed to thefunction as $0 .. $n.Run a set of commands in a group. This is one way to redirect anentire set of commands.This is similar to the `fg' command. Resume a stopped or backgroundjob. If you specifiy DIGITS, then that job is used. If you specifyWORD, then the job whose name begins with WORD is used. Following thejob specification with a `&' places the job in the background.The EXPRESSION is evaluated according to the rules for arithmeticevaluation. Equivalent to "let EXPRESSION".Returns a status of 0 or 1 depending on the evaluation of the conditionalexpression EXPRESSION. Expressions are composed of the same primaries usedby the `test' builtin, and may be combined using the following operators ( EXPRESSION ) Returns the value of EXPRESSION ! EXPRESSION True if EXPRESSION is false; else false EXPR1 && EXPR2 True if both EXPR1 and EXPR2 are true; else false EXPR1 || EXPR2 True if either EXPR1 or EXPR2 is true; else falseWhen the `==' and `!=' operators are used, the string to the right of theoperator is used as a pattern and pattern matching is performed. The&& and || operators do not evaluate EXPR2 if EXPR1 is sufficient todetermine the expression's value.BASH_VERSION Version information for this Bash.CDPATH A colon separated list of directories to search when the argument to `cd' is not found in the current directory.GLOBIGNORE A colon-separated list of patterns describing filenames to be ignored by pathname expansion.HISTFILE The name of the file where your command history is stored.HISTFILESIZE The maximum number of lines this file can contain.HISTSIZE The maximum number of history lines that a running shell can access.HOME The complete pathname to your login directory.HOSTNAME The name of the current host.HOSTTYPE The type of CPU this version of Bash is running under.IGNOREEOF Controls the action of the shell on receipt of an EOF character as the sole input. If set, then the value of it is the number of EOF characters that can be seen in a row on an empty line before the shell will exit (default 10). When unset, EOF signifies the end of input.MACHTYPE A string describing the current system Bash is running on.MAILCHECK How often, in seconds, Bash checks for new mail.MAILPATH A colon-separated list of filenames which Bash checks for new mail.OSTYPE The version of Unix this version of Bash is running on.PATH A colon-separated list of directories to search when looking for commands.PROMPT_COMMAND A command to be executed before the printing of each primary prompt.PS1 The primary prompt string.PS2 The secondary prompt string.PWD The full pathname of the current directory.SHELLOPTS A colon-separated list of enabled shell options.TERM The name of the current terminal type.TIMEFORMAT The output format for timing statistics displayed by the `time' reserved word.auto_resume Non-null means a command word appearing on a line by itself is first looked for in the list of currently stopped jobs. If found there, that job is foregrounded. A value of `exact' means that the command word must exactly match a command in the list of stopped jobs. A value of `substring' means that the command word must match a substring of the job. Any other value means that the command must be a prefix of a stopped job.histchars Characters controlling history expansion and quick substitution. The first character is the history substitution character, usually `!'. The second is the `quick substitution' character, usually `^'. The third is the `history comment' character, usually `#'.HISTIGNORE A colon-separated list of patterns used to decide which commands should be saved on the history list.Adds a directory to the top of the directory stack, or rotatesthe stack, making the new top of the stack the current workingdirectory. With no arguments, exchanges the top two directories.+N Rotates the stack so that the Nth directory (counting from the left of the list shown by `dirs', starting with zero) is at the top.-N Rotates the stack so that the Nth directory (counting from the right of the list shown by `dirs', starting with-n suppress the normal change of directory when adding directories to the stack, so only the stack is manipulated.dir adds DIR to the directory stack at the top, making it the new current working directory.You can see the directory stack with the `dirs' command.Removes entries from the directory stack. With no arguments,removes the top directory from the stack, and cd's to the newtop directory.+N removes the Nth entry counting from the left of the list shown by `dirs', starting with zero. For example: `popd +0' removes the first directory, `popd +1' the second.-N removes the Nth entry counting from the right of the list shown by `dirs', starting with zero. For example: `popd -0' removes the last directory, `popd -1' the next to last.-n suppress the normal change of directory when removing directories from the stack, so only the stack is manipulated.Display the list of currently remembered directories. Directoriesfind their way onto the list with the `pushd' command; you can getback up through the list with the `popd' command.The -l flag specifies that `dirs' should not print shorthand versionsof directories which are relative to your home directory. This meansthat `~/bin' might be displayed as `/homes/bfox/bin'. The -v flagcauses `dirs' to print the directory stack with one entry per line,prepending the directory name with its position in the stack. The -pflag does the same thing, but the stack position is not prepended.The -c flag clears the directory stack by deleting all of the elements.+N displays the Nth entry counting from the left of the list shown by dirs when invoked without options, starting with zero.-N displays the Nth entry counting from the right of the list shown byToggle the values of variables controlling optional behavior.The -s flag means to enable (set) each OPTNAME; the -u flagunsets each OPTNAME. The -q flag suppresses output; the exitstatus indicates whether each OPTNAME is set or unset. The -ooption restricts the OPTNAMEs to those defined for use with`set -o'. With no options, or with the -p option, a list of allsettable options is displayed, with an indication of whether ornot each is set.printf formats and prints ARGUMENTS under control of the FORMAT. FORMATis a character string which contains three types of objects: plaincharacters, which are simply copied to standard output, character escapesequences which are converted and copied to the standard output, andformat specifications, each of which causes printing of the next successiveargument. In addition to the standard printf(1) formats, %b means toexpand backslash escape sequences in the corresponding argument, and %qmeans to quote the argument in a way that can be reused as shell input.For each NAME, specify how arguments are to be completed.If the -p option is supplied, or if no options are supplied, existingcompletion specifications are printed in a way that allows them to bereused as input. The -r option removes a completion specification foreach NAME, or, if no NAMEs are supplied, all completion specifications.Display the possible completions depending on the options. Intendedto be used from within a shell function generating possible completions.If the optional WORD argument is supplied, matches against WORD aregenerated.H@0I@pI@I@J@@J@J@J@K@@K@K@K@K@ L@pL@L@M@8M@hM@M@M@N@HN@N@N@N@(O@xO@O@O@(P@xP@P@Q@PQ@`Q@Q@Q@ R@hR@R@R@S@XS@S@S@0T@xT@T@U@XU@hU@U@U@ V@hV@V@V@V@8W@W@W@X@HX@X@X@p@9@p@9@9@:@H:@x:@:@:@p@:@0;@p@`;@;@;@p@<@H<@Y@(Y@hY@Y@Y@0Z@pZ@Z@Z@Z@Z@[@[@([@@[@X[@p[@[@p@[@\@\@P\@\@\@]@X]@]@]@ ^@h^@^@^@@_@_@_@p@ `@h`@`@p@`@0a@xa@a@b@Hb@p@b@b@c@`c@c@c@8d@d@d@`@p@e@Pe@e@p@e@f@Pf@f@f@g@Pg@g@g@(h@ph@h@h@i@Pi@i@i@p@i@0j@p@@j@pj@j@p@j@(k@p@hk@k@k@l@Xl@l@l@l@8m@Hm@m@m@n@`n@n@n@8o@o@o@p@`p@p@p@0q@Hq@q@q@r@Xr@r@r@(s@hs@s@s@(t@ht@t@t@@u@`u@u@u@8v@v@v@w@Xw@w@w@x@`x@x@x@Hy@y@y@ z@hz@z@z@@{@{@{@|@`|@p@|@|@}@0}@X}@p}@}@}@}@~@(~@8~@H~@X~@p~@~@~@~@~@~@p@~@@@@@p@@@@@p@@Ѐ@@0@@Ё@ @p@@@P@@@@@@؄@ @p@@@@@0@@@@ @h@@@@`@@@@8@P@@@؉@ @H@p@@Ȋ@@8@@@؋@@(@P@@@،@@(@p@@@@8@x@@@8@@@@0@h@@@(@P@@@@p@(@h@@@8@p@@@H@@Д@@P@@@(@p@@Ȗ@@P@@@(@p@h@@ؘ@ @ؘ@ @`@@@@X@@@p@(@p@8@`@@Л@@(@h@@؜@@P@@@@0@h@@؞@@`@@p@@@@p@h@p@@p@@p@@p@(@8@p@h@@@С@@ @p@@p@آ@p@@0@`@@p@@ @p@P@@@@(@h@@@@P@@ئ@ @h@@@8@@Ш@@0@x@p@@Щ@@`@p@@Ȫ@@p@ @h@@p@@p@@`@@@@H@p@x@@ȭ@@ @X@@Ȯ@@(@H@h@@Я@p@@@@@ذ@ @h@@@@@@@в@@X@@@@P@@ش@@@@@е@@@@(@8@H@P@@ȶ@@H@@ȷ@@H@@ȸ@@X@@ȹ@@X@@@(@X@@@H@@@ @`@ @@Ƚ@@H@`@@@@P@@ؿ@ @P@@@p@@@p@@@p@8@@@@@@x@@@@H@p@@@P@h@@@@`@@@@P@@@@(@h@@@@(@X@@@@8@@@@@X@@@@H@@@@8@p@@@(@h@@p@@0@p@p@@@p@p@@P@p@@@p@@(@h@@p@@@8@p@p@@@p@0@x@p@@@@@@p@x@@@P@@@(@p@p@@p@@@8@x@@@8@x@@@@`@@@@@@@ @h@@@8@@@@`@@./alias.defaalias %s=%s bind_builtinlvpVPsSf:q:u:m:r:x:%s: cannot read: %s`%s': cannot unbind`%s': invalid keymap name%s can be invoked via , "%s"%s...`%s': unknown function name%s is not bound to any keys. `XH@0( ػлȻؿxpx@H0loop countonly meaningful in a `for', `while', or `until' loop%s: not a shell builtin./cd.defOLDPWD=PWD=LPCDPATHHOME not setOLDPWD not setwrite error: %schdirpvVcommand_builtin./command.def/bin:/usr/bin:/usr/sbin:/sbin%s: usage: %s: numeric argument required%s: not found%s: invalid option name%s: invalid number%s: invalid signal specification`%s': not a pid or valid job spec%s: %s out of range%s out of rangeargument%s: no such job%s: no job controlno job control%s: restrictedcommon.c`'%s: could not get current directory: %s: %s %s: ambiguous job specSIGJUNKUnknown%d %2d) %s%s: cannot destroy array variables in this waycannot use `-f' to make functionscan only be used in a function+afiprtxF./declare.def p h ` X P H @ 8 0 (    p h X P H @ 8 0 H   8 ./echo.defneEadnpsf:enable %s enable -n %s ./enable.defcannot find %s in shared object %s: %scannot open shared object %s: %s%s: not dynamically loaded%s: cannot delete: %s!  ! !@! !%s: not a regular file%s: file is too largeevalfile.c_evalfileparse_and_execute_topparse_and_executepe_disposeevalstring.c./exec.defcla:%s: cannot execute: %sexit logout not login shell: use `exit'~/.bash_logoutThere are stopped jobs. %s %s${FCEDIT:-${EDITOR:-vi}}fc builtinno command found:e:lnrs./fc.def %chistory specificationbash-fccannot open temp file %sheeddddhdhdddXhdjob %%%d started without job controlhashing disableddlp:rt-t%s: hash table empty ./hash.def%4d %s builtin hash -p %s %s hits command%s ؁Ёȁ8؁%s: %s no help topics match `%s'. Try `help help' or `man -k %s' or `info %s'.Shell commands matching keyword%s ` %s %s: cannot open: %sThese shell commands are defined internally. Type `help' to see this list. Type `help name' to find out more about the function `name'. Use `info bash' to find out more about the shell in general. Use `man -k' or `info' to find out more about commands not in this list. A star (*) next to a name means that the command is disabled. acd:npsrwcannot use more than one of -anrwhistory position%5d%c %s ./history.def%s: history expansion failedph`XPH@808  lpnxrsno other options allowed with `-x'./jobs.defjobs_builtinahrPx0hXأ@80(`%s: no such pid(%ld) - %sno other directory./pushd.def%2d %s %2d %sdirectory stack emptydirectory stack indexdirstack./read.defread_builtin%s: invalid file descriptor specificationread error: %d: %sersa:d:n:p:t:u:%d: invalid file descriptor: %s%s: invalid timeout specificationxph`XPH@h0( can only `return' from a function or sourced scriptoffallexportbraceexpanderrexithashallhistexpandinteractive-commentskeywordmonitornoclobbernoexecnoglobnolognotifynounsetonecmdphysicalprivilegedvixtraceset %co %s %-15s %s 10editing-mode./set.defSHELLOPTSfv%s: cannot unset%s: cannot unset: readonly %svariable%s: not an array variablecannot simultaneously unset a function and a variable%s -%s afnp%s: not a function-ra./setattr.defdeclare -%s ./shift.defshift count%s: file not found./source.deffilename argument requiredcannot suspendcannot suspend a login shell./test.deflptrap -- %s %s ./trap.deftrap -- %s %d unknownHN@NQQ(N NNNNNMMMMM0PMMMMPPOafptP-typepath-path-all./type.def%s is %s %s is hashed (%s) %s is aliased to `%s' %s is a shell keyword %s is a function %s is a shell builtin [XXXXXXXXXXxXpXhX`XXXPXxZ@X8X0X(X@ZXXXXWWWWWYWWWWcore file sizeblocksdata seg sizekbytesfile sizemax locked memorymax memory sizeopen filespipe size512 bytesstack sizecpu timesecondsmax user processesvirtual memory./ulimit.def`%c': bad commandunlimitedlimithard%s: cannot modify limit: %ssoft%s: cannot get limit: %s(-%c) (%s, -%c) %-18s %16s%04lo octal numberSpumask%s -Su=%s,g=%s,o=%s agou`%c': invalid symbolic mode operator`%c': invalid symbolic mode characterrwxOPTARG?./getopts.defcdable_varscdspellcheckhashcheckwinsizecmdhistdotglobexecfailexpand_aliasesextglobhistreedithistappendhistverifyhostcompletehuponexitinteractive_commentslithistlogin_shellmailwarnno_empty_cmd_completionnocaseglobnullglobprogcomppromptvarsrestricted_shellshift_verbosesourcepathxpg_echopsuoqcannot set and unset shell options simultaneously%s: invalid shell option name-sshopt %s %s -u./shopt.defhP0@#'-+ 0hjlLtz./printf.def`%c': invalid format characterL`%s': missing format characterwarning: %s: %smissing hex digit for \xXPH( سгȳ8xphȷ(زȲP8H@80( xphXPH@80( xpX hPH@80( hHп8%s: option requires an argument -- %c %s: illegal option -- %c compgen: -F option may not work as you expectcompgen: -C option may not work as you expectarrayvarbindingdirectoryenabledhelptopichostnamegroupjobrunningservicesetoptsignaluserdefaultdirnamesfilenamesnospaceabcdefgjko:prsuvA:G:W:P:S:X:F:C:-r%s: invalid action name./complete.def%s: no completion specificationcomplete -o %s -a-b-d-e-f-g-j-k-v-A %s %s %s -G-W-P-S-X-F-Cx`phXPHh0( X@(pXgetenv.csetlinebuf.citos.csocketconnectnetopen.c%s: bad network path specification%ldm%d.%03dsmakepath.csh_makepathpathcanon.cpathphys.csh_realpath/tmp/var/tmp/usr/tmpTMPDIRtmpfile.cshtmp%s/%s-%luw+%s%s stringlist.cstringvec.cshquote.cssssrrrrrrrrrrrrrrrrxrprhrPrHr@r(r0r8r rrrrrrqqqqqqqqqqqqqqqxqpqxq`qXq`qXqPqHq@q8q0q(q qqqqqppppppppppppppxppphp`phpPpXpPpHp@p8p0p(p pppppooooooooooooooxopohorxrrrrqqqqqqqqqqqqqqqqxqpqqqqqq@qqqqqxqqqqpppppppppppppppppphp`pXpPpHp@p8p0p(p pppppooooooooooooooooopoo`oXoPoHo@o8o0o(o ooooonnnnnnnnnnnnnnnn8nstrtrans.cpppppxppphp`pppppppxpppppppooooooooorooooooxopoho`oXoPoHo@o8o0o(o oooooonnnnsrqnqqnnnnnxnpnXq`nXnPn(q@nq0np nxo@uHu uutttssxspshs`sXsPsHs@s8s0s(s tssssrrrrrrrsrrrrrrrrxrprhr`rXrPrHr@r8r0r(r rrrrrqqqqqqqqqqqqqqqqxqpqhq`qXqPqHq@q8q0q(q q(r%s/cur%s/tmp%s/new%s/%scurnew%s/invalid base0123456789ABCDEF0123456789abcdef4.3OAOBOCODOHOF hl^$0ftFT;,%wbeWBE|_*\AaIiCcDdPpYyRrSsXx~(arg: %d) l|h^0bB l|hwW^0bB l|h^0%bBabortaccept-linearrow-key-prefixbackward-bytebackward-charbackward-kill-linebackward-kill-wordbackward-wordbeginning-of-historybeginning-of-linecall-last-kbd-macrocapitalize-wordcharacter-searchcharacter-search-backwardclear-screencopy-backward-wordcopy-forward-wordcopy-region-as-killdelete-chardelete-char-or-listdelete-horizontal-spacedigit-argumentdo-lowercase-versiondowncase-worddump-functionsdump-macrosdump-variablesemacs-editing-modeend-kbd-macroend-of-historyend-of-lineexchange-point-and-markforward-backward-delete-charforward-byteforward-charforward-wordhistory-search-backwardhistory-search-forwardinsert-commentinsert-completionskill-whole-linekill-linekill-regionkill-wordmenu-completenext-historynon-incremental-forward-search-historynon-incremental-reverse-search-historynon-incremental-forward-search-history-againnon-incremental-reverse-search-history-againoverwrite-modepossible-completionsprevious-historyquoted-insertre-read-init-fileredraw-current-linerevert-lineself-insertset-markstart-kbd-macrotab-inserttilde-expandtranspose-charstranspose-wordstty-statusundouniversal-argumentunix-line-discardunix-word-ruboutupcase-wordyankyank-last-argyank-nth-argyank-popvi-append-eolvi-append-modevi-arg-digitvi-back-to-indentvi-bWordvi-bwordvi-change-casevi-change-charvi-change-tovi-char-searchvi-columnvi-completevi-deletevi-delete-tovi-eWordvi-editing-modevi-end-wordvi-eof-maybevi-ewordvi-fWordvi-fetch-historyvi-first-printvi-fwordvi-goto-markvi-insert-begvi-insertion-modevi-matchvi-movement-modevi-next-wordvi-overstrikevi-overstrike-deletevi-prev-wordvi-putvi-redovi-replacevi-searchvi-search-againvi-set-markvi-substvi-tilde-expandvi-yank-argvi-yank-to "\'`@$><=;|&{("'--More--/Display all %d possibilities? (y or n) readline: bad value %d for what_to_do in rl_complete %s%s outputs %s C-\M-~/.inputrcINPUTRCreadline: %s readline: %s: line %d: %s Control-C-CTRL-MetaM-otherterm=mode=$else found without matching $if$endif without matching $ifendifincludeunknown parser directiveno closing `"' in key bindingprefix-metablink-matching-parenbyte-orientedcompletion-ignore-caseconvert-metadisable-completionenable-keypadexpand-tildehistory-preserve-pointhorizontal-scroll-modeinput-metamark-directoriesmark-modified-linesmark-symlinked-directoriesmatch-hidden-filesmeta-flagoutput-metapage-completionsprefer-visible-bellprint-completions-horizontallyshow-all-if-ambiguousvisible-statsbell-stylecompletion-query-itemsisearch-terminatorskeymapnoneaudiblevisibleDELESCEscapeLFDNewlineRETReturnRuboutSPCSpaceTabemacs-standardemacs-metaemacs-ctlxvi-movevi-commandvi-insert\M-\C-%c\C-?# %s (not bound) %s is not bound to any keys %s can be found on ... "%s": %s "%s%s": "%s" set %s %s %s is set to `%s' set bell-style %s bell-style is set to `%s' set comment-begin %s comment-begin is set to `%s' set completion-query-items %d completion-query-items is set to `%d' set editing-mode %s editing-mode is set to `%s' set keymap %s keymap is set to `%s' set isearch-terminators "%s" isearch-terminators is set to "%s" h`XPH@80؜МȜxph`XPH@80( ؛xH xp`XPX@(0 H  (\%oreadline: debug: insert_some_chars: count (%d) != col (%d) 0(@XؑБȑАȐ/-_=~.#$~coli@7DCclcrdceiicim@kIkdkekhklkrkskummmopcupvbvsve amkmxnMT = ;&()|<>unknown expansion errorno previous substitutionunrecognized history modifiersubstitution failedbad word specifierevent not found:$*%^() <>;&|$"'`\`"${zy0yhx`؉Љȉxph`XPH@80( ؈ЈȈxph`XPH@80H ؇pPp ~ ~Hx`XPH@80( Pxph`XPH@80( @@xph`XPH@80(`xph`XPH0`glob.casciialnumalphablankcntrldigitgraphlowerprintpunctupperxdigitNULSOHSTXETXEOTENQACKalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4FSIS3GSIS2RSIS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusminusdashperiodfull-stopzerotwothreefourfivesixseveneightninecolonsemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscoregrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettilde?*+@!sm_loop.csmatch.cp@G@G@G@G@G@G@G@G@G@G@Z@G@.@G@ 8` @ H .////////01(1/////x/p/h/`/X/P/H/@/8/0/(/ ///(/ /SPUHU@U8U0U(U UUVVUTTTTTTTTTTTTTTTTxTpTTTNULSOHSTXETXEOTENQACKalertBSbackspaceHTtabLFnewlineVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusminusdashperiodfull-stopzeroonetwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscoregrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELasciiwordalnum?*+@! malloc: %s:%d: assertion botched bcoalesce: CHAIN(mp2) != mp1malloc_debug_dummy malloc: block on free list clobberedfree: called with already freed block argumentfree: called with unallocated block argumentp->minfo.mi_magic2 == 0x5555free: start and end chunk sizes differfree: underflow detected; mh_nbytes out of rangenunits < 30realloc: called with unallocated block argumentrealloc: start and end chunk sizes differrealloc: underflow detected; mh_nbytes out of rangec(ddcccccijiiiiixi@@PV` @PV`@PV`P@PV` @PV`0 @PV` @PV` @PV`0 @PV`P @PV`p@PV`@PV`@ @PV` @PV` e @PV`: @PV`@PV`P@PV`@PV`7@PV`pU @PV`H@PV`P @PV`.@PV`b @PV`0 @PV` @PV`@ @PV`@PV`@PV`@PV``W@PV` @PV`a @PV`0E@PV`@PV`a @PV`@PV` @PV` @PV`p@PV` @PV`0@PV``@PV` ` @PV` @PV`PT @PV`@PV`M @PV`g @PV`@PV`K@PV` @PV` @PV` @PV` @PV`Z @PV`k@PV` @PV`д @PV` @PV` L@PV`@Z @PV` @PV` @PV`0k @PV`@PV`@PV`P@PV`P@PV``e @PV`0G@PV` @PV` @PV`&@PV`@PV` @PV`@PV`@PV`P@PV`@PV` @PV` @PV` @PV`@PV`b @PV`?@PV`pF@PV` @PV` @PV` @PV` &@PV`2@PV`@PV`_ @PV`p@PV` @PV` @PV`@PV`Z @PV` @PV`e @PV`P @PV`@PV`@PV`@PV`@PV`@PV`M @PV`S@PV`_ @PV`` @PV`@ @PV` @PV` @PV` @PV` @PV`p @PV` @PV`p@PV`@F@PV`p @PV`@PV`S@PV` @PV` 4@PV` @PV`P_ @PV`j @PV`0P @PV``_ @PV`p@PV`p @PV`@PV` _ @PV`T @PV` @PV` @PV``@PV`E@PV` @PV` @PV` @PV`@PV`0@PV` @PV` @PV` @PV` @PV`p@PV`X @PV`@PV`J@PV`V @PV`0@PV`! @PV`@PV`P@PV` &F 3`G QEQE !$aF0aF'aF" aBF! F!a.F%aF!a$F!aEF%aiF"3`F"F"aYF$aF! aWF%aF= aaF%a-auF&  aj8F!a?F!>F!>F!a3F&aF ,F%-F#)F7 aa F$aKF#anF!/F, aaF -F!auF%aF"a[F"aF!aIF5aF+aF'aya!F"a(F#aB)F"aMF"a4F#aZF!?F!-F a$F$3a'F$a<a3F& a1F"a(F!-F!;F"a?F#a@F#aTF!adF!a=F#a=F$aF#a=F&aOF#aRF#a"F#aIF' ac&F" ,F!,F"a'F"/F% 5F%7F"<F* aF#3F$a-F$a-F% 5F$4F#a$F$8F!8F"a'F$a-8F-aF&a(a`F& 8F#3F# aHF$aVF!0F!,F$aF$?F"aF%aF#a=F#aXF#a=F#ajF!a%F'a?F$a?F$aiF!;F#aF!6F&aF$aBF#a!F% a^F&aF%aF' aF"a%F"a1F0 3a)F"a1F(  +*F$aF!a@F!aOF&aUF#a:F$a(F"a$F$a1F#a9F!/F!4F!*F!a*F0a"a `IF+ aF$a7F aHF' a]aF#aOF"8F"aWF1aF ?F!4F!<F"a%F$aF#aWa`F#aF"a+F#a78F$aiF">F#a.F$a%F!a4F"aXF! a!F#9F#a7F"a+F"/F!a.F#a3F"95F#a!F#a!F#+F$;F!a"F$,a'F!a(F$a7F!a#F!a+F a<F"/F"9F"a?F! 7F!5F">F&aF#a0F#a-F%afF"9F"a/>F%aF%a_F%a^F$a?F" /F$a{F&aF#aXF!+F"a9F&aF!aJF!+F!a*F#;F"a"F)a`F#aFF#a-F(  aXF!5F"?F!6F!8F"amF(aF%aKF%a[F"9F.aF"?F"?F'aF) asF#aF$aQF$a0F#a7F#a-F# a4F!a6F#a"F# a1F$aUF# <F 8F"a=F"a0F"a!F"9F%asF -F )F!<F!,F a!F!;F!<aNF!,F"a>F!a<F )F"a=F a.F!a%F"a+F!a$F)aa*F$aZF!-F"a+F$;F"a%F%aNF"a%F%a'F&a6F#3F#5F$>F$>F%a3F#8F$aWF$a0F$a$F& aF"a3F a*F!5F)  ,a@F) ,a%F) ,2F) ,<F) ,a%F* -a&F+.aaa0F" aF!ayF%a`F"F$aCF$aWF )F#aLF#6a*F"a0/F$aF+aF%aiF$6F# /F# /F# /F&ajaF 6F 6F a7F aCF#a'a'F#ao&F&aF"2F"aiF! ,F/aaF%ai&F a2F )F$aCF#akF!aVF+  aaF'  aa`F"a!F+ aa9F& aF%aWF'aF6aa-F'aF!>/F ,F )F aIF 8F!a-F$/a?F%  adF$  aRF"  a@F"/a<F)/aF! /F!a+F!5F )F&as2F'aa<F)aoa3F3 aaF)  aca-F&aHafF6 aaF0 aalF& aHa'F(a"aF,  a$auF, a'aF2aF(aF!/F"a3/F,a>F$aa*F#a[F&aaF#aXF"aRF"a'F&a`F(aa'F"a+F"a+F!a6F#aiF%a'F#-a6F#a4F$0acF#a(F$0,F"=F&ajF%a!F%as&F!5F&6a`F%ar5F&a'F%a!F">F&  aRa!F!4F&aF)aF%adF)aoF&>F&a.F&aFaxF$a$F# 8F%aDF% aHF"a1F*5aF+ a5`CF"aiF* aF- aF/ a>F(aF&abF$aXF!0F"2F 1F"a=F(arF$aF#a1F) arF&a-F"-F&a~F&a[F%aIF*  ajF"2F% a<F a3&F -F%aBF" a1F' a=aE?F%asF! a"F! a"F" <F"a6F#aH5F0aF% aF&8aEF- aa$F"a`F!5F!+F!+F a)F&aF!a(F$a8F#a(F#asF$aR`J (3QEQEP   $aRaHF*alF"5F";F%a[F!aAF$aTF$?F$aEF"6F$aF!>F&adF" a0&F!7F#a(F"6F!a0F"a-F"a%F";F%/F!+F"2F 5F!a F$aEF% a`F%a!F"*F!.F$aaa$F"axF%aLa$F# aQF#a$F#aOF'aF*a^aF ,F&,auF"a^F% ,a3F#aF!(F!agF#9F" ,F (F!(F"a!a$F" >a'F 0F!a9F!a<F"aF$?aTF$5auF#a!F$aF#a|F#a3a$F" ;aF!aOF$aF!as`G QEQE   !aaHF! a+F!>F!0F!9F!8F'aF"8F#a6F!=F'ajF!5F"?F!a'F!a'F( aF$aGF/aF!>F#a(F!>F$aKF#a&F$aF%aFF&aTF)aqF%a*F"a$F%aF#aFF!6F#6F'a[F+  avF0 2aF$ a"F%aUF$agF$aF2F"aBF"6F%a4F-aaHF%axF% aNF"aUF#a4F"aCF&  aFF&aFF$>F%a7aF*a=aF+ aw8F,  a[aF/aF6aF%a1F*a*F"aUF 9F! a'8F# /aKF# ,a]F!4F$ a'arF"aYF!a=F"a-F%aF!6F!a!F!2F +F!/F ,F!a-F(aF!a!F$aF >F!a"F#aOF!>F a%F#a`F& aaF 7F$a(F)aF!>F"a7F(aF!a">F!a4F$a*F!,F"a.F+aaF,aF%aF$aF#amF(aF#aF"a%F"a+F#a=F%a=F <F <F%a$F"aHF(aF(aF#aKF"<F! ?2F!+F!+F(aF)aF'aF$<F!1F!1F)a$F!1F!1F!1F%aF$a=F"8F&4F"aZF%aFF'aF%aF ,F$a~F%ai5F"a4F$aOF$ a<F$aLF$6F/  aF+aF#,F!a$F#aF$aF">F!6F%aF"agF) aZa-F! aO#F!/F!,F!/F$a4F"a3F#aF+  aZaF"a3F'aF+ a*aF&aF%aCF"aEF$a9F%aF$aIalF"0F#a1a]F(a=G* a~aF&aUF!/F"3F!3F#a6F"-F-aF(a|F)amF)aNF!+F$a$F"a:F"aOF"aOF!+F!+F#a.F(aF#a<F#<F!+F#<F#<F,aF#aCF%aF$a-F)aF"a7F%a:5F!a"F&axF)aF*  aF%.F+aaF&aFF >F"arF%aF!0F 1F!4F"a7F$aNF!6F!=F"a'F"a!F"a'F!/F$a!F$a*F#/F$aF#aaF"a%F+ aF%alF"a'F!a9F!a9F!;F"a<F$ayF!a'F*3aF$aF&aF#a3F$aF!>F"a3F* -a=a'F!aIF!5F!;F"3F'a^F#aA8F"a<a!F$aF#a7F. aF"aaF, aa{F(acF!3F!3F!9F"9F 2F"6F1  a7aF(aF%aF% aRF"aCF1 aF&aZF!,F"aaF!a* `GF'aF"a'F!7F!aF,  a=aF!7F%aF#a,F$a9F#anF"aTF"a'F$aIa3F'aF$aEF!/F!/F"a%F& a\F+aF#aiF*a^a?F$a+aF&aF!a'F!a1F"a=F&ao)F%aEaF'aF' a'aF-aafF!a6a!F$ aaF%  aaF'  aaF"5F$>F#>F";F#a-F#a6>F$a<F%adF (F ,`F"F&a:F$>F#a3F2a1aF!3F+ aF%aF&8aTF&afF"a.F#>aEF#>aEF# a&aEF*aF( aF$aKF$aKF)aF,aBaF$a1F#aF +F$a7F,aaF&aF"aKF#aBF!a$F!3F!0F!/F#-F" >F#-F" >F$a'F%a)F$a1F#6F",F"+F!8F!8F ?F ?F ?F ?F!8F ?F! 2,F'  avaBF$a?F#aF"a(F%aF! 9F,aF#,F-  aaF$axF" ,a9F"a+F+ a^)F-aF#a'F"a7F$a<F!:F!=F#a$F'aXF*aF(apF-aF& a$F$a$F!<F&a(#F#9F!*F"*F#?F!8F&aXF&aCF",F!5F' afF'amF'a)F%aEF&ayF!aEF!aNF!aQF!aBF!aHF)aF&aF"a;F'  aFF+auF7 >aF' aF' aF#-a0F#a*F&a=F#a1F"a=F"aF$ai `I QEQE@  !aaF!9F!/F"+F(  aF"ajF!aF +F#aNF!9-F!0F";F#a9F",F!/F#a*F"9F"a#F#agF"9F#a9F#aAF#a+F&aF'aF(aF"1F%a=F"1F *F$ aBF!aXF";F"a!F&a&F)aF#aRF!a2F"6F(aF, aF"a.a0F(a[aF$a3a'F$aUF"a.F# asF)aF'aF" 3F"a%F'aRF!aOF!a+F!a:F%aRF$a-F%aZF >F!9F a.F#a.F"a!F$aGF$a`F*aaF")F")F 8F 8F(aF"aEF"a4F"a4F#a(F! 2F!0)F"aTF$a#F"5F"a$F"/ aPF$,aF"aAF 1F 1F!a`F$aTF!9F"a3F +F +F#a^F"?F! a=)F!a?F( aa?F$a!F-  aF&aUF&aiaWF4aa'F%a{F.aF$aF%a^F%ajF& aUaF&aF"?F,aaF'aQF$aF0aF)ayaF#2F%,9F"8F#.F$a"&F.5aF)aF&aF. aF$a@F$ a+a0F!-F" >F&aya?F!a%F%aF aEF <F& a!F&aF$aaF#a9F" a3F#a9F#a'F#aQF!a0F"a-F!a&F!8F!aOF#aia$F$a7F%a=F$a.F&aF:  aF0aF a-F. aF a-F&aF a-F#a(F"?F%aF: aaF%aF'aaF&a|F@  a aF3 aaF#aF a.F%aF%aQF$  avF#a;F)  , 6F 2F 8F"aFF$aF# a6F!<F#8F 8F%aF#aGF#avF 8F/ a"F!aSF!a#F 8F a+F&  ajF"aDF"a-F$a%)F# 3&F# a!aoF! a"aTF ;F 5F 8F!a+F!a-F )F$<F#a"F&aF'a:F",F"=F"=F"?F"?F"=F!8F'aF#a$F#a0F$a0F#a.F#a?F >F"amF!a$F$a7F#8F%  a7F"4F!a%F%ajF$afF#a`F$6F#a;F- aF 2F 2F#a"F!=F!a F!5F!a)F 9F!aKF#a4F!aEF"a9F!a+F"aLF!a!F'a8F a@F#5F$ajF!a0F#;aWF!a),F' aPF%aBF#aRaTF a/F%;F'aaF#a.F&a=F!,F!.F"-F#a/F ,F! a3F <F!?F"a$F%aF%agF$<F$ aBF"a;F$a]F"a+F#aNF&aF$axF a!F"a!F$aF)aafF%aa)F#>F a`F'aQF"a0F%aF$auF"aPF">F#avF* aF'aaF%  aF.aF#6F a!F a<F1 aF" )F /F!;F!:F"a-F!a-F#a3F!0F!a$F"/F /F"aZF"a_F"3F 5F!;F a(F#a:F$aF'a1a.F& aTF$a-F)aRaF!asF&aF*amaiF) a{F6 aaF4 a!aF#aF(aF3aF#aOF#aZF!*F( aLaoF' a=aF+aF-aF%a-F& aia9F' acF"a0F'a?F&aIF)a^F'aUF'a,F"a3F%a<F$>aF#a@F& ?afF(alF%a:)G%aa-G$aF!5F! 9G+  aNaF,   a@aG+aaF#6F" 2F"/F&aFF'aF&a F/aF#a3F/  aaF&2F+ aF"0F&a=F$  asa0F&a F.aF#a3F+aaF&2F+ aF(a<acF)aRa?F&;F&acF$aF"5F"*F"6F&a)F )F#axF(a6aF*aaQF)aaNF$a"F& ,F%9F#a"F#a"`hphp0hhhhhh i  8i ` Xi` xi i ij@"Pj@""pj" )j )*j*+j+0/jp/00k00 4(k 47Hk79pk9?k?@k@ Bk BKkKK@lKLXlLNplN Ql0Ql lpl m 0mHmhmPmPmm@m`m n 0nPn pn n`nЧn0n0o0oHoPhoPPoPopopo pPHpp hp pppppq q`Pq "pq#0$q0$9q9`9q`9;q;>r>@(r@@DHrPDEhrEJrJNrN RrTUr0VWsWY8sYZXsZ\xs\]s]]s]^s^`s`btbc8tcdXtePfxtPfftf`ht`hitiktkmum@o(uPpqHuquhuuvuvxuxzuz`{u`{}v}p(vpPv@hv@0v0v@v@v@v@ЈwЈ`(w`p@wp`w w w0wwPwP@x@Б xБHxhx@x@ЛxЛx`x`ПyП0y00yPy@hy@yPyP@y@yz(z`HzPhzPzPzPzpzppzp{8{X{ x{@P{P{`{`{p|@|`|||||}(}H}h}}}p}p}}@ ~@ 8~~!~!@'~@'P)~P)p-p-0/80/0X0`4x`4 : :0@0@ GGJJ L  LpN@pNpThpTUU`V`VPXPXYY@jj0o(0o{H{||00(@`Ȃ` ` @ XPpP00pȃ0Xлxлнн؄8Pp`ȅ(H`PxPpp @```xp0ȇPPP``p8pX@x@؈``8Xx@@Љ`0HphpPPpp  0 0    p 8p  P  hP0PPPPP ! !!8!"P"0'h0')*`.`.00Ȍ0112 3 4( 4p5Hp56h67799:ȍ:;;@<@<==>8>?X?@@x@@BB C C`CȎ`CDD`D`D0E0EE0E HH HpHppHII K K`Kȏ`KLLMMN NO@OP`PT@U@W@WWȐWXXPYPY0Z0Z[8[\X\]x]____ `Б ```aabbpc8pc`eP`efpf`g`g l l@mВ@m@n@nnnp(pqPqrxrsstȓtuu0yz}@}```00pp0 P @p@ЗЗЕPPPP0PpЖ00p0pXx0@@p 8PPPhؘ8`@x@00@Й0  @@@`PP00К000(P@PXx````0    @  X ȜPP0  p! )@ ).h...33:؝:<<??pI8pI`O`pOPPQQ`Q`QSОSSSTTpV(pVXPXZxZ@\@\]ȟ]Pccdde0eePeeh@g0j0j`n`nqРqpxpx{ {pHppp8`0p``йй   8 X( H PhPȤ@@8pXp x PPХ00 8 `00@`8Xx    اp000P@p@``+Ȩ+//0@04`4P6P6<<@?Щ@?@@PIPIK8K PX PRRPWPW^Ъ^aag gHБpБжȫжPp  (0@p`pppȬ    (@XpppppЭPP`00PHPPhP``ȮPP(@`@@P @p@p`p Ȱ   080Ph@@@@@ @`"`"% &&в&`'`'`))P+ p,P.@./`/@1@11 3 6 66س699P:P::8:;P;p<pp<==>0? @ȴPAAA`B`BB0EE0E@FHpF0G`0GHHJJKK L LLLpOpOR@RT`T`V`V0W`W Yȶ Y0\\aaa0adHdfpf0h0hkklطlPnnpopoo0o pH p`p``pqxqsssȸs0u0uvv{ {@~@@~@h@pйp`` @`@@``(0@0ШXШp  ``Ȼpp0P`p  м00 @`p@@@@  P P@p`px о  0@00`000ppPP(PpPP    P P    0  P XP         ! ! # (% % H% ' ` ' )  ) p+ p+ + , 00 1 3 3 p4 8p4 p5 Xp5 9 x9 9 9 P: : `; `; ; ; < < `< `< `= 0`= 0@ P0@ A pA @M @M M M N N P P @Q @Q R  R @T @@T Z `Z Z Z [ [ `_ `_ `  ` `a `a e e g @g @h h@h @i @i i i j 0k w w @ @ ( 0 H0 h 0 0    P P ( ` H`  ` x     P P p 0p Pд h      @  P 0 (0 H @ `p x       @ ` @ @     P P  @ ` x 0  ` `  P P  8 P  h       P P ( P @p  ` 0 0         # 8# P% X% P' xP' ( ( , , 0 0 0 0 4 4 p5 @p5 C `C `E `E E F G 0G G G H I I I pM (pM 0P H0P R hR PT PT T T pU pU V V X X @Z @Z Z @Z Z XZ [ p[ _ _ a a a a b b b b pc pc g 0g i Pi w pw x x | | ~  ~    ` 8` X x P P  P P    0 p P 0 h0    ` `    ( H  h   P P   0 0   8 X x  @ @  @ @  0 P x   0 P    0 00 X P xP      0 0 P0  p 0 0         ( P @P  X  p     `" `" `$ `$ % % . 8 . 0 ` 0 p0 p0 2 2 3 3 A A PB 0C C HC U hU W W 0X 0X @` @` 0a 0a a 8a d Pd t pt pu pu x x y y z z @} @}  0   P Ђ pЂ       ( P HP h   ` ` @ @  @ @ 8 @ X@  ` ` p p   @ p 0 0   0 0   @ 0 h0 p p    ` `  (  @  ` ` `    ` ` 0 0    (  H  h P 0 ! ! `# `# $ $ @* @* 0+ 00+ , P, 2 p2 08 08 8 8 8 8 @ @ E E F 0F J PJ M pM pN pN R R R R @U @U V V `X 0`X ] P] P` pP` a a h h r s z  z ~ ~ 8 Ђ `Ђ Ѓ Ѓ @ Є Є   p (p H h Г Г  @ p ` ` ` 0` Ы XЫ         P 8P P XP м xм        P 0P X 0 p0   p   @ ` h `  `  P P   P 0P  X  x0     P P @" `" $ $ % 8% `& X`& & x& P' P' ' ' (  ( ( ( P) P) *  * + 0+ , P, 0- pP- - - @. @. . . 0/ 0/ / 0 1 1 2 (2 3 H3 4 h4 @5 @5 6 6 6 6 : ; p< `= A (pB pC HpC `G h`G H H pN pN N N pV pV Y Y Z 0Z [ X[ ] x] a a pb pb c c e  e e e pf 8pf Pg PPg Pi pPi l l o o 0t 0t u  u v v v 0v w Hw `x p`x x x y y pz pz { { } } ~ ~ ~ (~ P @P X    0 0  ` (` H h P  p p  p p ( H p  P P P P   @ 8@ @ X@ x  P P `  8 P XP x   P  p  ` `  0 P @ h@ @ @      ` 0` ` P p pppp@@ ` 8` P XP  x   p8pPPP@!p@!`#`#p(p(p*p*P,P,`-(-00H00 6h07::@;@; < <>>??@ @ B@ BD`DEEGGGGpHpHIIJ JpK@pKM`M O OUU@V@VVV0W0WWWZ(Zp\Hp\]h]^^__p`p`aabbc c@d@@deXepexpe g gpjpjkkPlPllln(opHpqhqrrss`sptvvPwPwxxPz0PzPЀxЀpp ( HphpЫЫ@@P(P P @p@p   8 P x    ` `` `H ` x   p p0 0 p8 ppX p  P P@ @    0@ 0 `   p p   ! !@# %& &-@ -P6` 6: :; ;@? ?@ @0F0FPG PGPH@PHI``IMxM@_@_ b`bdd@g@g(XP@@ @h0000@@0H0h0pp``@@ 8 X x@(@Pphp0pp00(H0h`@@`0`Pp00@@  `(0H0`pPP  00P@p@  P P        0 Hh0(PPPxP  !`"$$&&( ()@) -`P.`/`/0099::0<0<<(<<@<P=XP=`>p`>>>@@@@AApBpBEE H8HIXIKpK`L`L`NNOO@QQTT`W0`W XP XXpX[[`b`bdeef h0hj8j kX koxoq@rttttPwwp|p|~0~Pppp@@ppЎ Ў0( `@ `X p  @ @   `!` !8!X!`x!`!!!!`Ц"Ц "@"X"px""p"@"@#(#H#pp#p#0#0##$8$P$x$@$@ $  $ 0%0p(%pP%p%%%%`%` & !8&! &X& &'&'*&*-&p/0&26'08`;8'`;;X';<p'<E'EK'K`T'`TT(TU((UU@(UWX(W\x(\](]i(ik(kw(z{ ){8)X)0p)@)@)`)`)*`@*`X*`x*`*0*0`*`+  + p8+pP+h+0+0++ + ,@,@`,@x,p,p@,b@_@ ^@Pf@ @`(@@`8@`H@(`0@`@$`P@``@`p@`x@`@`@H`@$`@ `@`@@@@@@@@ @  @ (@ 0@ 8@@;@@@{/@}H@P@X@`@h@p@x@@ @!@#@$@%@"@&0@@'@(@)@>@<@-@@{/@}8@;4@(H@)@|@&@ {();&| $  @ @ @P @ @ @` @@ @p @x @ @ @ @ @ @ @ @0 @( @PS@@@ @ @ @ @ @ @ @@@ @0@a`b`e`f `h<`i0`k`m,`n`pP`rH`t`u `v$`x(`C`I8`P4`BT`H@`+@@ @(@0@8@@@H@P@X@`@h@p@x@@@@@@@@@@@@@@@@ @ @ @ @0 @@ @P @` @p @ @ @ @ @ @ @ @ @!@!@ !@0!@@!@P!@`!@p!@!@!@!@!@!@!@!@!@"@"@ "@0"@8"@@ @   @_@/@1@2@0f@a@f@`_@g@g@b@Pd@a@f@e@f@_@pc@0`@d@``@<@@<@<@@<@<@@<@x=@ @=@=@ @=@@@=@=@(@=@=@@>@@ @@>@@>@@@@@@>@@>@@H>@x>@@>@>@@>@>@@>@>@@>@(?@ @0?@@?@@H?@h?@ @p?@@ P@?@8@h@8@?@x@?@ @@?@@0@@@@@P@ @@H@@P@@@@h@@@@`@@@A@@A@(A@@0A@A@ @A@A@X@A@B@ @B@ B@ @(B@XB@ @`B@B@0@B@B@p@B@C@ @C@C@ @ C@Т@ @0C@@C@@HC@XC@ @`C@X@0@pC@C@H@C@p@ `@C@C@@C@C@@C@D@`@D@(D@@0D@@@@D@pD@@xD@@@@D@D@@D@@@D@@@8E@ @ @E@(@8@E@;@P@E@F@p@F@ F@@(F@@F@@PF@hF@@xF@F@8@F@F@@F@F@h@G@G@@ G@8G@@@G@xG@@G@G@@G@PH@@@XH@ @a( @B@^@_@8 @e@ @hH @H@`_@ @X`pa@X @D`p @kx @m @C @n @f @` @b @u @t @Px@`@g@ @p@v @^@_@ @xc@@d@@f@@l@@m @@n0@p@@P@s`@@tp@@u@v @@0@(`@@X`H@`X@`h@`p@ܞ`x@,`@ `@`@`@`@`@ `@Ď`@D`b@@`@` @Ȟ`0@ `H@̔`X@`h@0`x@$`@L` `@@0`@`@x`<@a(@8@@b@c@@ d@@P@B@e`@f;@X@h@ x@g@@jp @k@@s@8G@@ @ @@u @v@@@@,@,@(,@@,@P,@.@`,@x,@,@,@,@,@,@,@-@0-@G@@-@X-@p-@-@-@-@-@-@-@.@.@ .@0.@H.@X.@h.@x.@.@.@.@/@.@.@.@/@ /@8/@H/@X/@h/@x/@/@/@/@/@0@H0@X0@p0@0@0@0@/@0@0@0@0@1@1@(1@81@H1@X1@`1@x1@1@1@1@1@1@1@1@2@2@ 2@82@H2@X2@h2@x2@2@2@2@2@2@2@2@2@3@3@(3@83@P3@`3@p3@3@3@3@3@3@3@3@4@4@ 4@(4@84@H4@X4@h4@x4@4@4@``5@5@5@5@5@@^@86@`@@_@@6@ g@6@`6@`6@`6@`6@`7@@`7@ ` 7@X`87@`P7@``7@`x7@`7@`7@`7@`7@`7@D`8@`8@`88@`P8@``8@@b@X,@e@p8@g@ @d@8@e@8@ b@8@8@8@8@ 8@ 8@ 8@ 8@9@ 9@ 9@ @x`9@x`(9@`89@` @ `H9@ `P9@ ``9@0`0?@p`8?@8` @(`@П`@?@`H?@`P?@`X?@``?@`h?@ `p?@h`x?@x`?@8`?@X`?@``?@H`?@@`?@P`?@0`8@0`?@ `?@(`?@`?@`?@`?@`?@`C@C@@@H@H@H@H@ H@(H@0H@8H@@H@HH@XH@ `H@ hH@ @ pH@ xH@ H@ H@ H@ H@ H@H@H@H@H@H@H@H@H@I@I@I@I@8@ I@(I@0I@8I@@I@HI@PI@8 @Z@ XI@!pI@"I@#I@$I@%I@&I@'I@(I@)J@*J@+ J@,(J@-0J@-@J@-HJ@-PJ@.XJ@.x[@/PK@/hJ@0hD@1pJ@2xJ@3J@4J@5J@6J@7J@8J@9J@:J@;J@<J@=J@>K@?K@@ K@[8K@\HK@\XK@]pK@^K@^K@_K@`K@{K@{K@|K@}L@}L@~8@8O@HO@XO@hO@xO@O@O@O@O@O@O@ P@ P@ (P@ HP@ XP@ P@ P@ P@ P@ Q@(Q@8Q@HQ@XQ@hQ@xQ@Q@Q@Q@Q@Q@Q@Q@Q@R@R@(R@8R@HR@XR@hR@O@ xR@!R@"S@#0S@$`S@%S@&S@'S@(8T@)T@*T@+T@,T@-U@-@U@-XU@-pU@.U@.@X@/xX@/U@0U@1U@2U@3V@4 V@58V@6HV@7`V@8xV@9V@:V@;V@<V@=(W@>pW@?W@@W@[0X@\XX@\X@]X@^ Y@^hY@_Y@`Y@{Z@{PZ@|Z@}Z@}[@~ [@ @ @ @ @ @ @``@@.@ k pPV`PV`@0O@^ oN@oo@@4@`0^@@@@@@8@X@h@@@@@ @0@@@X@p@@@@@@^@@p@@P@P^@`^@p^@@@@p@h@p@@@@@@^@G@p@Т@@@@0@@@x@@@ @&@p@8@@@ @@@(@@@h@@@@@@@@@@@ @(@X@p@x@@@@@^@^@^@*@+@ +@^@^@_@*@*@*@@*@ _@@@@ @@ @ @@@@@0_@@_@P_@p_@+@;@(@0@H@`@p@@@_@@@@@@@PS@ 1@Т@@@ A@ @_@@@@ @=@0@8@@@0@H@@P@`@p@=@@_@@p@P@`@+@@@@@`@@@ @?@H@@@@@p@`@h@@@@`@8+@@HL@L@8M@8N@@P`@@p`@`@`@0@@`@`@`@@@H@4@H@P@X@B@`@h@@p@@@@( @@@@@p@@@@ @@0@8@X@x@@@@@@@ @@h,@@@@@@@ @@(@0@8@X@@@(@8@H@@`@`@$@a@3@3@3@4@4@p@(4@84@/@ a@0a@@a@@@Pa@p@0@ @ @ @ @ @ @0@0@1@X;@`a@ @ @ @ @ @@@@ @( @8 @H @P @h @;@ @ @ @@@@0@@@@@ @0@@"@X"@x"@"@"@"@p@#@0#@@#@P#@`#@a@a@@@@Т@@@@@@@@@@@H@P@X@h@Т@p@@@%@(@@@p@ @X:@@@@@H@`@@x@@a@a@@@@`@@(@8@X@@h@@@@x@p@x@ @@@@@@@0@H@@(@@8@@P@;@X@h@@@8G@@ @@@@@@@@@p@PH@@@a@C@E@a@(?@B@h@x@@p@>@@5@5@>@F@@@p@G@@@@@@@@0@H@@@`@Т@a@X5@`5@p5@x5@5@5@5@@ @5@6@H6@ B@h6@6@6@8@P@8@ @8@8@ @p9@x9@9@9@9@9@9@(@9@ @@X@9@p@@5@:@:@(:@@:@`:@x:@h,@:@:@:@:@;@(;@@;@`;@@@@@@@@ @@@H@X@p%@( @@@@ @p@b@0b@Pb@p@#@`b@@ @P @pb@b@@@Т@@@@p @@@ @@!@@Т@b@ @&@'@(@@*@b@@b@@@@@@@8@`@@#@ @ @@@@@P@h@x@@@@@@P@@@@p@@@@@@P@@@@ @(@8@@@P@`@p@@@@@@@@ @(@@@8@P@p@@ @&@`@p@@@@@p@p@@@h@@@b@@@(@b@8@0@X,@h,@p,@@@x,@,@,@,@,@,@,@-@(-@@-@`-@x-@-@-@-@-@.@ .@8.@X.@p.@.@.@.@.@.@/@ /@` @0/@P/@@`/@p/@x/@/@p@/@/@/@/@`@PS@/@X@/@0@0@(0@h0@0@0@P>@c@c@ c@,@ @ @ @P @p @,@ @@ ,@@0,@p@0c@@2@2@`3@@p#@x#@#@@c@+@@@M@Pc@@`c@c@@@x@@@@@@@@@ @0@@@H@X@p@(@0@8@@@P@X@`@p@`@h@p@x@@@@@(@@p@@@P@h@p@@x@@@@@@ @c@c@ @ @@ @p@ @ @x"@c@x@@`@0@@@@@5@@@@@P@h@@c@c@c@c@d@ ?@(?@@@@?@?@@@@@@@@@@ d@0d@@d@@@@=@ @ @ @ @0 @@p@+@x@ @`d@pd@$@*@*@*@*@*@*@*@@+@P+@`+@+@+@+@+@+@@@0@@@d@d@d@]@]@d@` @x @C@ @d@`4@p4@d@d@P @ @@ @e@@@PS@@p@`@@ e@0e@0@01@81@P1@p1@1@1@@@1@2@@e@@@@@@@@@@p@Pe@`e@8@@P@@p@@@@@@@@@@@@@@@@@@pe@e@%@&@0&@@&@P&@h&@&@@&@&@e@e@4@4@4@@5@Т@@8@8@9@X9@@@@@PS@@@@@@@ @ @ @ @@( @0 @8 @@ @@P @` @p @ @ @ @@@ @ @@ @ @ @ @ @ @@ @@@@@( @0 @Т@` @@p @x @ @ @@@x@@ @ @ @ @ @ @ @ @ @p@( @8 @x @ @ @ @ @( @0 @@@@@@@@@@@ @8@X@p@x@@@@@@@PS@@@@@@@ @(@@@`@h@x@@@@@@@ @0@p@@@@@P@e@@@@e@e@f@ f@*@+@ +@@f@0@`f@pf@+@ +@(+@?@ @C@ @ @ @ @@`@ @p @;@ @<@( @@ @X @p @@ @@@f@f@f@f@@@8@X@@p@@@ L@(L@G@8L@0@@@@@f@f@@P@@@x@@@@@@p@@ @@X@@@(@P@@@@@ @P@x@@@@8@p@@@@@8@@@@@@@@@@@(@0@8@@@@@h@@@8@@@g@g@0g@@@+@H+@P+@X+@`+@h+@p+@x+@+@+@+@+@@@"@P@@@l@@"@0@~@x@0@( @Pg@`g@@@@p@@8@@@@@@@@@@@p@@@8@@@@@@ @(@8@8@@@0@@H@X@/@`@@p@*@@ @(@x@@@@@@@@@@@@@@@@@@@@H@@@ @(@0@@8@@@@H@P@X@`@x@@@@@@@@@pg@ @[@[@[@[@\@H\@x\@\@\@\@]@8]@h]@@p@0@@@p@@@@@@@@@@@@ @g@+@+@+@,@g@@@@0@8@H@ @ @P@(@0[@H[@`[@x[@@`@g@g@p@PV`@PV`@PV`@PV`@PV`@PV`о@PV`@PV`@PV`@PV`@PV` @PV`0@PV`@@PV`P@PV``@PV`p@PV`@PV`@PV`@PV`@PV`@PV`п@PV`@PV`@PV`@PV`@PV` @PV`0@PV`@@PV`P@PV``@PV`p@PV`@PV`@PV`@PV`@PV`@PV`@PV`@PV`@PV`@PV`@PV` @PV`0@PV`@@PV`P@PV``@PV`p@PV`@PV`@PV`@PV`@PV`@PV`@PV`@PV`@PV`@PV`@PV` @PV`0@PV`@@PV`P@PV``@PV`p@PV`@PV`@PV`@PV`@PV`@PV`@PV`@PV`@PV`@PV`@PV` @PV`0@PV`@@PV`P@PV``@PV`p@PV`@PV`@PV`@PV`@PV`@PV`@PV`@PV`@PV`@PV`@PV` @PV`0@PV`@@PV`P@PV``@PV`p@PV`@PV`@PV`@PV`@PV`@PV`@PV`@PV`@PV`@PV`@PV` @PV`0@PV`@@PV`P@PV``@PV`p@PV`@PV`@PV`@PV`@PV`@PV`@PV`@PV`@PV`@PV`@PV` @PV`0@PV`@@PV`P@PV``@PV`p@PV`@PV`@PV`@PV`@PV`@PV`@PV`@PV`@PV`@PV`@PV` @PV`0@PV`@@PV`P@PV``@PV`p@PV`@PV`@PV`@PV`@PV`@PV`@PV`@PV`@PV`@PV`@PV` @PV`0@PV`@@PV`P@PV``@PV`p@PV`@PV`@PV`@PV`@PV`@PV`@PV`@PV`@PV`@PV`@@@ `@p@X@h*@p*@x*@,8,@H,@`GP@ @P@ @?-8+@x`+@i+@d4@4@g@ 5@=@?@ !^ @@(@@G` G`  .shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.IA_64.pltoff.init.plt.text.fini.rodata.opd.IA_64.unwind_info.IA_64.unwind.init_array.fini_array.data.dynamic.ctors.dtors.jcr.got.sdata.sbss.bss @@ !@,' .@./@k7o@@@ DoN@N`S0O@0O^]@p@@v@@@ {`@`p @@@ ^@ ^ h@hp,@, ```0(T`(T(V`(V8V`8VHV`HVPV`PV-b` `h`p p`N